KEGG   Gallus gallus (chicken): 395470Help
Entry
395470            CDS       T01006                                 

Gene name
ITGB8
Definition
(RefSeq) integrin subunit beta 8
  KO
K06591  integrin beta 8
Organism
gga  Gallus gallus (chicken)
Pathway
gga04510  Focal adhesion
gga04512  ECM-receptor interaction
gga04514  Cell adhesion molecules (CAMs)
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    395470 (ITGB8)
   04514 Cell adhesion molecules (CAMs)
    395470 (ITGB8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    395470 (ITGB8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    395470 (ITGB8)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   395470 (ITGB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 395470
NCBI-ProteinID: XP_003640734
CGNC: 49335
Ensembl: ENSGALG00000010875
UniProt: A0A1D5PZX6
Position
2
AA seq 787 aa AA seqDB search
MMWVPLLACLTAGIVSVPKCQRGPGALLGAVRLLAAVPGLCQRPENRCATSNAVTCTKCL
ALGPECGWCAQEDFMADSTQKGRCDTVFNLLKRGCQSDFVESPTVHVTIPSDQETNTQVT
PGRVSVQLSPGSEASFILKVRPLEKYPVDLYYLVDVSASMHNNIEKLNSVGFALSKKMEN
ISLDFRLGFGSYVDKTVSPYISIHPGRIHNQCSDYNLDCMPPHGYIHVLSLTDNIAEFRN
AVNKQKISGNIDTPEGGFDAMLQAAVCQSHIGWRKEAKRLLLVMTDQTSHLALDSKLAGI
VIPHDGNCHLKDNVYVKATSMEHPSLGQLSEKLIDNNINVIFAVQGSQFHWYKDLLPLLP
GTVARQIESQAANLNDLVVEAYQKLISEVKIQVDNHIQDLNFNITAICPDGSKKTGMEGC
KNIGYNQEVLFNVSVTMKGCDTTGGRKYAILKPIGFNETTIINVQKSCACQNGDNAKPKR
VWADEIFPDGKQPHCSDSGCSYSRETLPSEECRQHQDQPICSGRGDCIEGKCFCYKNKLG
RVYGKYCQMDDFSCPYHQGNLCSGNGECEAGKCKCFADWEGDRCQCSLQSAKQCLNSKGQ
ICSGRGNCVCGKCECTDPRSFGRLCEYCPACNTACEENWNCVQCHHSNNASQAKLDQCKT
SCAYLLHYVDQTSECFSGRSYFRVFSIIFIVTFLIGLLVVLIIRQIILQGNSNKVKSSAD
YRVSATKKIPLTRKRLAAQALQRGMKPKLQPLKPEEERDPSFSHFFDTSHVYNKEKNFGN
TLLLPWA
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgggtgccgctgctggcgtgcctcaccgcggggatcgtctccgtgcccaagtgc
cagcgcggccccggggccctcctcggggcggtccggctgctggcggccgtgcccggactc
tgccagcgcccggaaaacagatgtgccacttcaaatgcagtaacatgtacaaagtgtctt
gctctgggtccagagtgtggatggtgtgctcaggaggatttcatggctgactcaacacag
aagggacgctgtgacactgttttcaacttactgaaaagaggctgccagtcggattttgta
gaaagtcccacagttcatgttacaatacccagtgaccaagaaacaaatacacaagtgact
ccaggaagagtttcagtccaactgagtccaggaagtgaagcgagctttatcttaaaagtt
cgtcctctggagaagtaccctgtggatctttactatttagttgatgtctcagcttctatg
cacaacaatatagagaaactgaattccgttggatttgctttatcaaagaagatggagaat
atttctcttgattttcgacttgggtttggatcctatgtggataaaactgtgtcaccctat
attagcattcacccaggtagaatccataaccaatgcagcgattataatttagattgtatg
ccgcctcatggttatattcatgtgctatccctgactgacaatatagcagaatttagaaat
gcagtgaataaacaaaaaatttctgggaatattgatacacctgaagggggttttgatgca
atgctccaagcagctgtttgccagagccacattggatggcgcaaagaagccaagcggcta
cttcttgtgatgacagaccaaacttcccatctagccctagatagtaaattagcagggatc
gtgattccccatgatggaaactgccatttgaaagataatgtgtacgtcaaagctacgagt
atggagcatccatctcttgggcagctctccgaaaaattgattgataataacatcaatgtc
atttttgcagttcaaggaagccagttccattggtataaagatctgttacctctgttgcct
ggtactgttgcgagacagatagaatcacaagcagcaaatctcaatgatttggtggtagaa
gcttatcagaaactaatctctgaagtgaaaattcaagtggataaccatatccaggatctt
aatttcaatatcactgcaatctgtcctgacggaagcaaaaaaactggcatggaaggatgt
aaaaacattggatataatcaggaagtacttttcaatgtatcagtcacaatgaaaggatgt
gatacaaccgggggaagaaaatatgcaatacttaagcctattggtttcaatgaaaccacc
attattaacgtgcagaaaagctgtgcatgtcagaatggagacaacgcaaagcccaagaga
gtgtgggctgatgaaatctttcctgatggcaaacagccccattgcagtgacagcggttgc
agctacagcagagagacacttccttctgaggagtgcaggcagcaccaggaccagcccatc
tgcagtggccgaggagactgcatagagggaaaatgtttctgctacaagaacaagctaggc
agggtgtatggcaaatactgtcaaatggatgatttttcttgcccatatcaccagggaaac
ttatgttctggtaatggtgaatgtgaagctggtaaatgtaaatgctttgctgactgggaa
ggtgaccgttgccagtgttcattacaatcagcaaagcagtgcctgaattcaaagggccag
atttgcagtggaagaggaaactgtgtatgtggaaaatgtgagtgcactgacccaagaagc
tttggccgtttgtgtgaatactgccctgcttgtaacacagcctgtgaagaaaactggaat
tgtgttcagtgccaccattctaacaatgcatctcaagctaaacttgaccagtgtaaaacc
tcatgtgcttacctattgcattacgttgaccaaacttcagaatgtttctctggacgaagc
tactttagagtgttttccataatctttatagttacatttctgattgggttgcttgttgta
cttatcatcaggcagataattctgcagggaaatagcaataaagttaaatcttcagctgat
tacagagtctctgcgacaaagaagataccattgaccagaaaaaggcttgctgctcaagct
ctccaaagaggaatgaaacctaagttacagcctctaaagccggaggaggaaagagatcct
tctttcagccacttttttgacaccagtcatgtctacaacaaagagaagaactttggaaac
acactcctgctaccctgggcttga

DBGET integrated database retrieval system