KEGG   Gallus gallus (chicken): 395509Help
Entry
395509            CDS       T01006                                 

Gene name
PDGFRA, PDGFR, PDGFR-A
Definition
platelet-derived growth factor receptor, alpha polypeptide (EC:2.7.10.1)
Orthology
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    395509 (PDGFRA)
   04020 Calcium signaling pathway
    395509 (PDGFRA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    395509 (PDGFRA)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    395509 (PDGFRA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    395509 (PDGFRA)
  Cell communication
   04510 Focal adhesion
    395509 (PDGFRA)
   04540 Gap junction
    395509 (PDGFRA)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     395509 (PDGFRA)
Protein kinases [BR:gga01001]
 Tyrosine protein kinases
  PDGFR family [Table]
   395509 (PDGFRA)
Enzyme-linked receptors [BR:gga01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   395509 (PDGFRA)
Cytokine receptors [BR:gga04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   395509 (PDGFRA)
Cellular antigens [BR:gga04090]
 Proteins
  395509 (PDGFRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 1087 aa AA seqDB search
MGTPPRTFLILGCFLTGPLLTLCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGMYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSLPEDQFILVEEGDPTVIPCRTSDPSAEVTLVNSLDKPVYAFYDSKQGFVG
NFLAGPYTCKTMVKGVEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYMLTIPDVLVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSVLKLIRAKEEDSGTILWLLKNEDEIKRYTFSLLIQVPALILDL
MDDHQGSAGRQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
RNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSLSESEVKN
LLSDDGSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGILYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNNEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKIKDRESGFDEQRLSADSGYITP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgggtactcccccaaggacgttcctgatcctgggatgttttctcacaggaccgctccta
acactttgccagcttcctctgccgactattgttcccaatagaaatgagatggttgtacag
ctgaattccaatttcacactcaaatgctctggagacagcgaagtgagctggcagtacccg
gtgaccgagggaagccacaggatagacatcagacacgaggagaacaacagtggcctcttc
gtgacagtgcttgaagtcggaaatgcttcagccgctcacacgggcatgtatgtttgctat
tataaccacacgcaagtggaggatggggaagtcgaggggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttccttaccagaagaccagttcatcctagtagaa
gaaggtgatcccactgttatcccttgtcggacaagtgacccaagtgctgaagtgacttta
gttaacagtttagacaagcctgtctatgctttctatgacagcaaacagggcttcgtaggg
aacttccttgcaggaccatacacatgcaaaacaatggttaaaggcgtggagttcaagtcc
gatgagttcctcatctatattttaagagctacttcacagctgccggttgaaattgaagca
ctgaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcccgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcacagaagttggtttacatgttgaccatacctgatgta
ttagtgaaagacacaggggattatgaatgtactgcccgacatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaagggttcattcatctagagcctcaa
tttagccctttggaagctgtcaatctacatgaagtcaaaaattttgtcgtcgatgtgcag
gcgtaccccgctccaaaaatgtactggttgaaggataatgtgactctgattgaaaacctt
actgagattgttactagttcaaacagagtccaggaaacacggtttcaaagtgtactaaaa
ttgatccgggccaaggaagaagacagtggtactatactttggttgctgaaaaatgaagat
gagattaagagatacaccttctcgttgctaatacaagttccagccttgatcttagacctc
atggacgaccaccaaggctctgctggcaggcagacagtgaggtgcttggctgaaggtacc
ccgcttcctgatgtggaatggttggtttgcaaggacattaaaaaatgcagcaatgacact
tcctggactcttctgactaacaacatctctgatatacacatggaagcccacctggatgag
aggaatatggtggaaagccaggtgaccttccagaaggtagaagaaaccctggctgtgaga
tgtgtagcaagaaatgaccttggagctgttactcgggaactgaaacttgtggctcccacc
ttgcgatcagaactgacggtggctgctgctgtcttagtactgctggtgattgtgataatt
tcactgattgtcctggtcatcatctggaaacagaagccaaggtatgagataagatggaga
gtcattgagtctatcagccccgatggccatgaatacatttatgtggacccaatgcagcta
ccttatgactccagatgggagtttcctcgagatgggctagtgcttggtcgaatccttggt
tctggtgcatttggaaaagtggtggaagggacagcatatggattgagtcgttctcaacct
gtgatgaaagtagccgtgaaaatgctgaaacctacagctagatccagcgaaaaacaggcg
ctcatgtctgaactgaagataatgacacatcttgggccccacctgaatattgtgaacctg
cttggagcttgtacgaaatcaggtcctatttacataatcactgaatactgcttttacggt
gatttggtgaactatctgcacaagaacagggacaacttcctcagccgacatccagagaaa
ccaaagaaagatctggatatttttgggatgaacccagctgatgaaagcacaagaagctat
gtgattttatcatttgaaaacaccggagaatatatggatatgaaacaagctgataccact
cagtatgtgccaatgctggaaaggaaggagggatctaaatactctgatattcagagatct
gtatatgatcgacctgcttcatataagaagaaatctttgtcagaatcagaagtaaaaaac
cttctttcagatgacggttcggagggtctaagcctactggatttgctaagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgcgtacaccgtgacttggca
gctcgtaatgtccttctggctcaaggcaaaatcgtgaagatctgcgactttgggttggct
agagacatcatgcatgattccaactatgtctccaagggcagcaccttcctcccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtatacaacattaagtgatgtctggtct
tatggtattctgctgtgggaaatattttctctaggtggtatactatatcctggcatgatg
gtcgactccaccttctacaataagataaagagtggctaccgaatggcaaaacctgatcat
gctaccaatgaagtgtatgagatcatggtaaagtgctggaacaatgaaccagagaaaaga
ccttcgttttaccatctgagtgaaattgtggagagcttgttgcctggagagtacaaaaag
agctacgagaagattcacctggacttcctgaaaagcgatcacccagctgtcactcgaatg
agaggggactgtgacaatgcttacattggtgtcacctacaagaatgaagacaagataaag
gatagagagagtggatttgatgagcagaggctgagtgctgacagtgggtacatcaccccc
ctgcctgacattgaccctgtttctgaagatgagcttggcaaaaggaacaggcacagttcc
cagacatctgaagagagtgccattgaaaccggttccagtagctctacctttataaagaga
gaggatgagaccattgaggacattgacatgatggatgacattggaattgactcctcggat
cttgtagaggacagcttcctgtaa

DBGET integrated database retrieval system