KEGG   Gallus gallus (chicken): 395509Help
Entry
395509            CDS       T01006                                 

Gene name
PDGFRA, PDGFR, PDGFR-A
Definition
(RefSeq) platelet-derived growth factor receptor, alpha polypeptide
  KO
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    395509 (PDGFRA)
   04020 Calcium signaling pathway
    395509 (PDGFRA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    395509 (PDGFRA)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    395509 (PDGFRA)
  Cellular community - eukaryotes
   04510 Focal adhesion
    395509 (PDGFRA)
   04540 Gap junction
    395509 (PDGFRA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    395509 (PDGFRA)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     395509 (PDGFRA)
Protein kinases [BR:gga01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   395509 (PDGFRA)
Enzyme-linked receptors [BR:gga01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   395509 (PDGFRA)
Cytokine receptors [BR:gga04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   395509 (PDGFRA)
CD molecules [BR:gga04090]
 Proteins
  395509 (PDGFRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
4
AA seq 1087 aa AA seqDB search
MGTPPRTFLILGCFLTGPLLTLCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFMTVLEVGNASAAHTGMYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSLPEDQFILVEEGDPTVIPCRTSDPSAEVTLVNSLDKPVYAFYDSKQGFVG
NFLAGPYTCKTMVKGVEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPDASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSVLKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALILDL
MDDHQGSAGRQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
RNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSLSESEVKN
LLSDDGSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKIKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgggtactcccccaaggacgttcctgatcctgggatgttttctcacaggaccgctccta
acactttgccagcttcctctgccgactattgttcccaatagaaatgagatggttgtacag
ctgaattccaatttcacactcaaatgctctggagacagcgaagtgagctggcagtacccg
gtgaccgagggaagccacaggatagacatcagacacgaggagaacaacagtggcctcttc
atgacagtgcttgaagtcggaaatgcctcagccgctcacacgggcatgtatgtttgctat
tataaccacacgcaagtggaggatggggaagtcgaggggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttccttaccagaagaccagttcatcctagtagaa
gaaggtgatcccactgttatcccttgtcggacaagtgacccaagtgctgaagtgacttta
gttaacagtttagacaagcctgtctatgctttctatgacagcaaacagggcttcgtaggg
aacttccttgcaggaccatacacatgcaaaacaatggttaaaggcgtggagttcaagtcc
gatgagttcctcatctatattttaagagctacttcacagctgccggttgaaattgaagct
ctgaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcctgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcacagaagttggtttacacgttgaccatacctgacgca
tcagtgaaagacacaggggattatgaatgtactgcccgacatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaagggttcattcatctagagcctcaa
tttagccctttggaagctgtcaatctacatgaagtcaaaaattttgtcgtcgatgtgcag
gcgtaccccgctccaaaaatgtactggttgaaggataatgtgactctgattgaaaacctt
actgagattgttactagttcaaacagagtccaggaaacacggtttcaaagtgtactaaaa
ttgatccgggccaaggaagaagacagtgggtactatactttggttgctgaaaatgaagat
gagattaagagatacaccttctcgttgctaatacaagttccagccttgatcttagacctc
atggacgaccaccaaggctctgctggcaggcagacggtgaggtgcttggctgaaggtacc
ccgcttcctgatgtggaatggttggtttgcaaggacattaaaaaatgcagcaatgacact
tcctggactcttctgactaacaacatctctgatatacacatggaagcccacctggatgag
aggaatatggtggaaagccaggtgaccttccagaaggtagaagaaaccctggctgtgaga
tgtgtagcaagaaatgaccttggagctgttactcgggaactgaaacttgtggctcccacc
ttgcgatcagaactgacggtggctgctgctgtcttagtactgctggtgattgtgataatt
tcactgattgtcctggtcatcatctggaaacagaagccaaggtatgagataagatggaga
gtcattgagtctatcagccccgatggccatgaatacatttatgtggacccaatgcagcta
ccttatgactccagatgggagtttcctcgagatgggctagtgcttggtcgaatccttggt
tctggtgcatttggaaaagtggtggaagggacagcatatggattgagtcgttctcaacct
gtgatgaaagtagccgtgaaaatgctgaaacctacagctagatccagcgaaaaacaggcg
ctcatgtctgaactgaagataatgacacatcttgggccccacctgaatattgtgaacctg
cttggagcttgtacgaaatcaggtcctatttacataatcactgaatactgcttttacggt
gatttggtgaactatctgcacaagaacagggacaacttcctcagccgacatccagagaaa
ccaaagaaagatctggatatttttgggatgaacccagctgatgaaagcacaagaagctat
gtgattttatcatttgaaaacaccggagaatatatggatatgaaacaagctgataccact
cagtatgtgccaatgctggaaaggaaggagggatctaaatactctgatattcagagatct
gtatatgatcgacctgcttcatataagaagaaatctttgtcagaatcagaagtaaaaaac
cttctttcagatgacggttcggagggtctaagcctactggatttgctaagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgcgtacaccgtgacttggca
gctcgtaatgtccttctggctcaaggcaaaatcgtgaagatctgcgactttgggttggct
agagacatcatgcatgattccaactatgtctccaagggcagcaccttcctcccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggcattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gtcgactccaccttctacaataagataaagagtggctaccgaatggcaaaacctgatcat
gctaccaatgaagtgtatgagatcatggtaaagtgctggaacagtgaaccagagaaaaga
ccttcgttttaccatctgagtgaaattgtggagagcttgttgcctggagagtacaaaaag
agctacgagaagattcacctggacttcctgaaaagcgatcacccagctgtcactcgaatg
agaggggactgtgacaatgcttacattggtgtcacctacaagaatgaagacaagataaag
gatagagagagtggatttgatgagcagaggctgagtgctgacagtgggtacatcatcccc
ctgcctgacattgaccctgtttctgaagatgagcttggcaaaaggaacaggcacagttcc
cagacatctgaagagagtgccattgaaaccggttccagtagctctacctttataaagaga
gaggatgagaccattgaggacattgacatgatggatgacattggaattgactcctcggat
cttgtagaggacagcttcctgtaa

DBGET integrated database retrieval system