KEGG   Gallus gallus (chicken): 395600Help
Entry
395600            CDS       T01006                                 

Gene name
CNMD, CHM-I, LECT1
Definition
(RefSeq) chondromodulin
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 347 aa AA seqDB search
MAEGSEKVPIARAGPEDVEQGLPPAYTAAVPPPGPGRLLKAGATVLIAGALLLLAGAIGA
FYFWKATERQVYNVHYTMSINGKVQDGSMEIDAGNNLETFKTGSGSEEAVEVHDFQIGIT
GIRFAGGEKCYIKAQPKARVPEVDAMTKASLSSDLEDEIMPVRFDENSLIWVAADEPIKH
NGFLSPKILELCGDLPIFWLRPTYPKDKQRERREMKRNKRQSESNFDAEHRAAAAEEVNT
RSTPTQLTQDLGPQSNETRPMQQESDQTLNPDNPYNQLEGEGMAFDPMLDHLGVCCIECR
RSYTQCQRICEPLLGYYPWPYNYQGCRTACRIIMPCSWWVARIMGVV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggccgagggctcggagaaggtacccatcgcccgagcggggcccgaagacgtggagcag
ggcctgccgcccgcatatacggcagcagtgccccctccggggccagggcggctgctgaag
gcaggggccactgtgctcatcgctggggcccttctgctgctggctggggccatcggtgcc
ttctacttctggaaagccactgagaggcaggtctacaacgttcactacaccatgagcatt
aatggaaaagtgcaagacggatcgatggaaatagatgccggaaacaacttagagacattc
aaaacaggaagcgggagtgaagaggctgttgaagttcatgatttccagattggcatcacc
ggcatccgatttgctggaggagagaagtgttacatcaaggcccagcccaaagctcgtgtg
cctgaggtggatgccatgaccaaggccagcctgtcctctgacctggaagatgaaatcatg
cctgttagatttgacgaaaactctcttatctgggtggctgcagacgagcccatcaagcac
aacggtttcctaagccccaaaattttagagctttgtggggatcttccgattttctggctt
cgacctacatatcccaaagataaacaaagagaaaggagagaaatgaagagaaataaacgc
cagtccgagtcaaacttcgatgcagaacacagagcagctgctgctgaagaggtgaacacc
aggtccacccccacccagctgactcaagatcttggcccccagtcgaatgaaaccaggcca
atgcagcaagaaagcgatcaaacacttaacccagacaacccatacaaccaactggaaggt
gaagggatggcttttgaccccatgctggaccacctgggcgtgtgctgcatcgagtgcagg
cgaagttacacgcagtgccagaggatctgtgagcctctgctgggctactacccgtggcca
tacaactaccagggctgccgcactgcctgccgcatcatcatgccctgcagctggtgggtc
gctcgcatcatgggcgttgtgtga

DBGET integrated database retrieval system