KEGG   Gallus gallus (chicken): 395610Help
Entry
395610            CDS       T01006                                 

Gene name
ANGPT2, ANGIOPOIETIN-2
Definition
angiopoietin 2
Orthology
K05466  
angiopoietin 2
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
3
AA seq 407 aa AA seqDB search
MASLMIQLENYIQDSMKKEMVEIQQTAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQV
LNQTTRLELQLLEHSLSTNKLERQISVQTNEITKLQEKNSFLEKRVLEMEDKHTLQLKSI
KDEKDQLQVLVARQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHNLLTMISTPNSAK
KNFIAKEEQISFKDCAEAFKSGLTTSGTYTLTFPNSAQEKKAYCDMESNGGGWTVLQRRE
GGSVDFHRTWKEYKIGFGDPAGEYWLGNEFVSQLTNQKRYVLKIILKDWEGNEAYTLYDQ
FYLANEEQKYRIHLKGLTGTAGKISSISQPGNDFSTKDTDNDKCICKCSQMLTGGWWFDA
CGPSNLNGMYYPLRQNNNKFNGIKWYYWKGSGYSLKATTMMIRPADF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatcactgatgattcagcttgagaattacatccaagacagtatgaagaaagaaatg
gtagagatccagcaaactgcagtgcagaaccagactgcagtaatgattgaaataggcaca
aacttactaaatcaaacagctgagcagacccgcaaattaacagatgttgaagcacaagta
ctaaaccagacaaccagacttgaacttcagcttttggaacattccctttcaacaaataaa
ttagaaagacagatttctgttcagaccaacgagataactaaattacaagaaaaaaacagc
tttctagaaaaaagagttcttgagatggaagacaagcacacacttcagctgaagtcaata
aaagatgaaaaagatcagcttcaagtcctagtagccagacagaattccattatagaagaa
ctagaaaagcagttagttacagctacggtaaacaactccgttctgcaaaaacagcaacat
gatttgatggagactgttcataacttacttactatgatatctacaccaaactcagctaag
aagaacttcatagctaaagaggagcaaatcagcttcaaagactgtgctgaagctttcaaa
tctggactcacaacaagtggaacctacaccttaacatttcctaactctgcacaggagaag
aaggcctactgtgacatggaaagtaatggaggaggttggacagttcttcagagacgtgaa
ggtggcagcgtggattttcaccggacatggaaggagtacaagataggatttggtgatcct
gctggggagtactggctaggaaatgagtttgtttctcaactgactaatcagaagcgctac
gttcttaagataatcctgaaagactgggaaggaaatgaagcgtacactttgtatgaccaa
ttctatctagcaaacgaagaacaaaaatacaggatccaccttaaaggacttactgggaca
gcaggcaaaataagtagtataagccaaccaggaaatgattttagcacaaaggatacagac
aatgacaaatgtatttgcaaatgttcacaaatgctaacaggagggtggtggtttgatgct
tgtggtccttctaacctcaatggaatgtattatccattacgacagaacaacaacaagttc
aatggtatcaagtggtactactggaaaggctcaggatactctctcaaagccacgactatg
atgattcgaccagcagatttctaa

DBGET integrated database retrieval system