KEGG   Gallus gallus (chicken): 395623Help
Entry
395623            CDS       T01006                                 

Gene name
CER1, CAR
Definition
(RefSeq) cerberus 1, DAN family BMP antagonist
  KO
K01645  
cerberus 1
Organism
gga  Gallus gallus (chicken)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    395623 (CER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
Z
AA seq 272 aa AA seqDB search
MSLLLLQLLVLSCLGDTEPQPDSQQRKRRPLQHLFYLDRNLLESQSFHELVGENPVGVKE
TQEEPSFFIAFPQTAGESQKQGEKKMSRFILPNAELYAHQDLRTWAAPKEISPVENFSPS
YYSNKRDVEPPYRKDAKKFWDHFMLRKNSASEEVVLPIKTNEMHQETCRTLPFSQSVAHE
SCEKVIVQNNLCFGKCSSFHVPGPDDRLYTFCSKCLPTKFSMKHFDLNCTSSVPVVKKVM
IVEECNCETQKIEDPLLGSLQSDFLGNVPEHN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgctcctccttcagctgctagtgctctcgtgtcttggagacacagagccacag
ccagattcacagcaaaggaaaaggcggccacttcagcaccttttctatttggacagaaac
ttacttgaaagccagagttttcatgagttggtgggggaaaacccagtaggtgttaaggaa
acccaggaagagccaagcttttttatagcatttccacagacagcaggagagagtcagaag
caaggggagaaaaaaatgtccagattcatccttcctaatgcagaactctatgcacaccaa
gatctgagaacctgggcagcacccaaagagatctctcctgtggaaaacttctctccatcc
tactattccaacaagagggatgttgaacctccctatagaaaagatgccaaaaaattctgg
gaccatttcatgttaaggaaaaattcagcttctgaagaggttgtcctgccaatcaagacc
aatgaaatgcaccaagaaacttgcagaaccctgcctttttcccagagtgttgctcatgag
agctgtgagaaggtgatagtccagaacaatctatgttttggcaagtgtagttcctttcat
gttcctggtccagatgatcgtctttataccttttgttctaaatgcctgcccaccaagttt
tccatgaagcacttcgatctcaactgcaccagttctgtcccagtggtcaaaaaagtcatg
attgtggaagagtgtaactgtgagactcagaagatagaagatcctctgcttggatctcta
cagtcggattttcttggaaatgtacctgagcacaattaa

DBGET integrated database retrieval system