KEGG   Gallus gallus (chicken): 395635Help
Entry
395635            CDS       T01006                                 

Gene name
HDAC2
Definition
histone deacetylase 2 (EC:3.5.1.98)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
gga  Gallus gallus (chicken)
Pathway
Cell cycle
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:gga04330]
Cellular Processes; Cell growth and death; Cell cycle [PATH:gga04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSEVSMVNNFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKADVKEEDKSKDNSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcagggcggcggcaagaagaaagtctgctactactacgatggtgatatt
ggaaactattactatggacaagggcatccaatgaaacctcataggatccgaatgactcac
aacttgctcctaaattatggcttgtacaggaaaatggaaatttaccgaccccacaaagct
actgctgaggaaatgaccaagtaccatagtgatgaatacatcaaatttctcagatcaata
aggcctgacaatatgtctgagtacagcaagcagatgcaaagatttaatgttggagaagat
tgtcctgtatttgatggcctgtttgagttttgtcagctgtcaactggaggctctgttgct
ggggcggtaaaattgaacagacagcagacagacatggctgttaattgggctggaggactt
caccatgccaagaagtcagaggcatctggtttttgttatgtcaatgatattgtgcttgcc
atccttgagttactgaagtatcaccaaagagtgttgtatattgatattgatatccatcat
ggtgatggtgttgaagaagcattttataccacagatcgtgtcatgactgtgtcagaggta
agtatggtgaataattttccaggcacaggggaccttagggacattggtgctggaaaaggc
aaatactatgctgtcaactttccaatgagggatggtatagatgatgagtcgtatggacag
atattcaaaccaattatatcaaaagtaatggagatgtaccagcccagtgctgtagtatta
cagtgtggagcagattcattgtctggtgataggttgggatgctttaatcttactgttaaa
ggtcatgcaaaatgtgtggaagttgtaaagaccttcaacttgccattgctgatgttagga
ggaggtggatatactattcgcaatgttgctcgatgctggacatatgaaactgctgttgcc
ttagattgtgaaattcctaatgaattaccatacaatgattactttgagtattttggacca
gacttcaaacttcatattagtccatcaaatatgactaatcagaatacaccagaatatatg
gaaaagatcaagcaacgcttatttgaaaacttgcgcatgttacctcatgcacctggtgta
cagatgcaggccattcctgaagatgctgttcatgaagatagtggagatgaggatggagaa
gatccagacaaacgcatttctattcgagcatctgataagcgcattgcctgtgatgaggag
ttttcagactctgaagatgaaggggaaggtggacggcgaaatgttgcagatcacaagaaa
ggagcaaagaaagctaggatagaggaagacaagaaagagacagaggacaaaaaagcagat
gttaaggaggaggataaatccaaggacaacagtggtgaaaagacggacaccaaaggagca
aaatcagaacagctcagcaatccttga

DBGET integrated database retrieval system