KEGG   Gallus gallus (chicken): 395644Help
Entry
395644            CDS       T01006                                 

Gene name
USP15, UNP
Definition
ubiquitin specific peptidase 15 (EC:3.4.19.12)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     395644 (USP15)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   395644 (USP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 981 aa AA seqDB search
MAEGGAADLETQRTDVAALLKTALRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDSQSLKEHLIDELDYILLPTEGWNRLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPGEKETRLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGSSTPKSPGASNFSTLPK
ISPSLSNNYNNMNNRNVKNSNYCLPSYTAYKNYDYSEPGRHNEQPGLCGLSNLGNTCFMN
SAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKYSYVTPRA
FKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEE
AWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVFLV
RMDPLAKPMQYKVVVPKIGNILDLCTALSALSGVAADKMIVTDIYNHRFHRIFAMDENLS
SIMERDDIYVFEIAINRTEDTEQVIIPVCLREKCRHTSYSHSGSSLFGQPFLIAVPRNNT
EDKLYNLLLLRMCRYVKTCTETDDSEGSLRCCKEHGINGNGPNGIHEEGSPSEMETDEQD
DESSQDQELPSENENSQSEDSVGGDNDSENGLCTEDTCKGQPLTGHKKRLFTFQFNNLGN
TDINYIKDDTRHIRFDDRQPRLDERSFLALDWDPELKKRYFDDSAAEDFEKHESVEYKPP
KKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYS
RYMRDKLDTLVGFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDD
GKWYYFDDSSVSIACEDQIVSKAAYVLFYQRQDTISGTGFFPLDRETKQGASAATGIPLE
SDEDSNENDNDIENENCMHTN
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggaggcgcggcggatctggagacccagcgcacggacgtggcggcgctgctc
aaaaccgccctccgcaagggcgacacctggtatctagtggatagtcgctggttcaaacag
tggaaaaaatatgttggtttcgacagctgggacaaatatcaaatgggagatcagaatgtc
taccctggtcctattgataattctggacttctcaaagatggtgattctcagtctctcaaa
gaacatctcattgatgagctggactacatcctgttgccaactgagggctggaataggcta
gttagctggtacacgctaatggaaggtcaagagccaatagcacgcaaggttgttgaacag
ggtatgtttgtaaagcactgcaaagtagaagtatatctgacagaattaaagctttgtgaa
aatggaaatatgaacaatgttgtcacgcgaagatttagtaaagctgatacaatagataca
attgaaaaagagataagaaaaatcttcaatattccaggtgaaaaagagaccagattgtgg
aacaaatacatgagtaatacttttgaacctttgaataaaccagatagtaccatacaagat
gctggtttataccagggacaggtactggtaatagaacagaagaatgaggatggaacatgg
ccaagaggttcttcaactcctaagtccccaggtgcatccaatttttcaactttaccaaag
atctctccatctctatcaaataattataacaacatgaacaacagaaatgtgaaaaattca
aattattgtctcccatcatatactgcttataagaattatgattattcggagccaggaaga
cataatgaacagccaggcctgtgtggcctgagcaacttggggaatacgtgtttcatgaat
tcagcaattcagtgtctgagcaacacacctcctcttacagaatattttctcaatgataaa
taccaagaagagttgaactttgacaatcctttgggaatgcgtggtgaaattgcaaaatct
tatgcagagctcatcaagcaaatgtggtcaggaaaatacagttatgttaccccaagagca
tttaagacacaagtgggacgatttgcaccacagttttctggttatcagcaacaagattgt
caagagctactggcttttctcttggatggcttacatgaggatttgaatcgaattaggaaa
aagccgtatattcagttaaaagatgcggatggaagaccagacaaggtagttgctgaagaa
gcctgggaaaaccatttaaaaagaaatgattccatcattgtagatatatttcatggcctt
tttaaatccactcttgtctgtcctgaatgtgctaagatttctgtaacctttgatccattt
tgttatttgacacttccattacccatgaaaaaagaacgcactttggaagtttttttagtc
agaatggatccacttgctaagcctatgcagtacaaagtagtagttccaaaaattggaaat
atattggatctttgcacagcgttgtcggctctgtcaggtgttgctgcagataagatgatt
gttactgatatatacaatcataggttccacaggatatttgccatggatgaaaatctgagt
agtattatggaacgtgatgacatttatgtgtttgaaattgctatcaatagaacagaagat
acggaacaagttataattcctgtttgtttaagggaaaagtgcaggcacactagctacagc
catagtggttcctcactgtttggtcaaccttttctcatagcagtgcctagaaacaacact
gaagataaactgtataacctgctgctgctaagaatgtgccgatatgtaaaaacatgcact
gaaactgatgacagtgaaggatccctacggtgctgtaaggaacatggtatcaatggtaac
ggcccgaatggaatacatgaagagggctctccaagtgaaatggaaacagatgagcaggat
gatgaatccagccaggatcaggagcttccttcagagaatgaaaacagccagtcagaagac
tctgttggaggtgacaatgactctgaaaatggattatgtactgaggatacttgcaaaggt
caaccactcacgggacacaaaaaacgattgtttacattccagttcaataacttaggcaat
actgacataaattacatcaaagatgataccaggcatattagatttgatgacaggcaacct
aggcttgatgaaagatctttccttgctttggattgggatcctgagttgaagaagagatac
tttgatgatagtgcagcagaggattttgaaaaacatgaaagtgtggaatataaacctccc
aaaaagccttttgtgaaattaaaagattgcattgaactgttcacaacaaaggaaaaacta
ggtgctgaagacccatggtattgtccaaactgtaaagaacatcagcaagctaccaaaaag
ttagacttgtggtcacttcccccagtactggtagttcatctaaaacgcttttcctacagc
agatacatgagggacaagttggacacattggttggctttccaataaatgatttggacatg
tcagagttccttattaatccaaatgcagggccttgccgctacaacttgattgctgtctcc
aatcactatggaggaatgggaggagggcactatactgctttcgcaaaaaacaaagacgat
ggaaaatggtactactttgatgacagcagcgtgtcaattgcgtgcgaggatcaaatagtg
tccaaagctgcgtatgtgctcttctaccagagacaggatacaatcagtggaactggcttt
tttcctcttgaccgggaaactaaacaaggtgcttcagctgccacaggcatcccactagaa
agcgatgaagacagcaatgaaaatgataatgatatagaaaatgaaaattgtatgcacact
aactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system