KEGG   Gallus gallus (chicken): 395660Help
Entry
395660            CDS       T01006                                 

Gene name
PRLR, PRL-R, PRLRb
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
gga  Gallus gallus (chicken)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    395660 (PRLR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    395660 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    395660 (PRLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
Z
AA seq 831 aa AA seqDB search
MKQDLISSVQIILFLPLTTVGLAGQSFPGKPKIIRCRSLEKETFSCWWKPGSDGGLPTNY
TLFYSKDSEEEIYECPDYRTSGPNSCYFNKNHTSPWTTFNITVTATNEIGSNSSDPQYVD
VTSIVQPGSPVNLTLETKRSANIMYLWAKWSPPLLADASSNHLYHYELRIKPEEKEEWET
ISVGVQTQCKINRLNAGMRYVVQVRCTLDPGEWSEWSSERHILIPSGQSPPEKPTIIKCR
SPEKETFTCWWKPGLDGGHPTNYTLLYSKEGEEQVYECPDYRTAGPNSCYFDKKHTSFWT
IYNITVRATNEMGSNSSDPHYVDVTYIVQPDPPVNVTLELKKPINRKPYLVLTWSPPPLA
DVRSGWLTLEYELRLKPEEGEEWETIFVGQQTQYKMFSLNPGKKYIIQIHCKPDHHGSWS
EWSSENYIQIPNDFRVKDMIVWIVLGVLSSLICLIMSWTMVLKGYRMITFMLPPVPGPKI
KGIDTHLLETGKSEELLSALGCHGLPPTSDCEELLIEYLEVEDSEDQQLMPSHDNGHPSK
NAKITRKETDSDSGRGSCDSPSLLSEKCRETCALPPVLQTQEVRDVQEKKAAKRSWETQY
VASERKALLSNSESAKSSTWPAVQLPNSQPPMFAYHSIVDAHKITLNTTNTNVAAVLVED
EEEHQSQCSLTETIPGEMEKQGEMENLHSKTEQTTAQVKQNRSNERLPFLDAALMDYVEV
HKVIRQDEEPAVLLKHKENSGKIEKYTISGASKEYTKVSTVMDHNILVLMPDSRVPHTPA
SQEPAKETSQSLQQGQVEKNMSYCLTAPSDCKRETGGSEYMDPSSFMPSFK
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggatttgatatcgtctgttcaaatcatattgttccttcctctgaccacagtg
ggtctggcaggtcaatcattccctggaaaacctaagataataagatgtcgttctctagaa
aaggaaaccttttcttgttggtggaagcctggttcagatggaggacttcctaccaattac
accctgttctacagcaaggacagtgaagaagaaatctatgaatgcccagactacagaaca
tcaggtcccaattcctgctacttcaataaaaaccacactagtccgtggacaacattcaat
atcactgtaacagcaacgaatgagattggaagtaacagctcggatcctcagtatgtggat
gtgacctccatagttcagccaggttctcctgtgaatctcactctagaaacaaaaagatct
gccaatataatgtacctttgggcaaaatggtctccacctctattagctgatgccagctct
aatcatttatatcactatgagctacgaataaaacctgaggaaaaggaagagtgggagaca
atatctgttggggtacagacacagtgcaaaataaataggttaaatgctggcatgaggtat
gttgttcaggtccgctgtacgttagaccctggagaatggagtgaatggagctctgaaaga
cacattctgatccccagtggacagtcacctcctgaaaagcctacaataataaaatgccga
tccccagaaaaggaaacatttacctgttggtggaaacctggtttagacggagggcatcct
actaactatactttactttacagcaaagaaggagaagaacaagtttatgaatgtccagat
tacagaactgcaggccccaattcctgctactttgataaaaaacacacttctttctggacc
atatacaacattactgtcagggcaactaatgaaatgggaagtaacagctctgatcctcat
tatgtggatgtgacctacatagtacagccagatcctcctgtgaatgtaactctagaatta
aaaaagccaataaatagaaaaccatatctggtattgacatggtctccacccccactggct
gatgtcagatctggatggcttaccctcgagtatgaattgcgactgaagcctgaagaagga
gaggaatgggagactatttttgttggacagcaaacacaatataaaatgtttagtttaaat
ccaggaaagaagtacattatacagattcactgcaaacctgaccaccatggatcatggagt
gaatggagctcagaaaactatattcagattcctaatgatttcagagtaaaagatatgatt
gtgtggatcgttttgggtgtcttatcatctctcatatgtttaatcatgagctggacaatg
gttttaaaagggtacagaatgataacttttatgctaccgccagtgccagggccaaagata
aaaggcatagatacacatctattagagacagggaaatctgaagagctgttgagtgctctt
ggttgccatggcttgcctccaacatcagactgtgaggaactactgatagagtatctggaa
gtagaggacagcgaggatcagcagcttatgccaagtcatgacaatggtcatcccagtaaa
aatgcaaaaattacacgcaaggaaacagacagtgactcaggacgagggagctgtgatagc
ccttctctgctttctgaaaagtgcagggagacctgtgcccttccaccagtgcttcaaaca
caagaagtaagagatgttcaagaaaagaaagcggcgaaaaggagctgggaaactcagtat
gtagcctcagaacgaaaagcactcctttccaacagtgagagtgcaaaatcatccacatgg
cctgcagttcagttacctaacagtcagcctcctatgtttgcctatcacagcattgtagat
gcgcataagataacactgaataccacaaatacgaatgttgcagcagttttggtggaagat
gaagaagagcatcaatcacagtgttctctcactgaaaccatccctggagagatggaaaag
caaggagagatggagaatttgcattccaaaaccgagcaaaccacagcacaggtcaaacaa
aacaggtctaatgaaaggttaccatttttggatgctgcgcttatggattatgtagaagtt
cacaaagtcatcagacaggatgaggaaccagcagtgttactgaaacataaagaaaacagt
gggaagattgaaaaatacactatttcaggagccagcaaagaatacacaaaggtctcaaca
gttatggaccataatattctagtattaatgccagattcacgagttccgcacacgcctgca
tctcaagaacctgcaaaagaaacgtctcagagccttcagcaaggtcaagttgaaaaaaac
atgagctattgtctgacagctccaagtgactgcaaaagagaaactggtggatcagagtac
atggacccatcctcatttatgccctcctttaagtaa

DBGET integrated database retrieval system