KEGG   Gallus gallus (chicken): 395766Help
Entry
395766            CDS       T01006                                 

Gene name
USP2, UBP41, UBP46, ubp52, ubp66
Definition
ubiquitin specific peptidase 2 (EC:3.4.19.12)
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     395766 (USP2)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   395766 (USP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
24
AA seq 403 aa AA seqDB search
MAARMAPTPRAPRWCRGSTGLRNLGNTCYMNSILQCLSNTKELRDYCLQNQYLRDFNNNS
RMRTAFMSEFAKLIQLFWTSSPNDSVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDG
LHGEVNRVLVRPRANADTLDHFPDDEKSRQMWRRYQEREDSPVSDFFLGQLKSSLTSSEC
GYCSTAFDPFWDLSLPIPKKGYGEVTLMHCLPLFTKEDLLDGDEKPTCCRCKARTRCTKK
FSIQKFPKILLLHLKRFSEARIRASKLTTFVDFPLKDLDLREFASQSCNHAVYKLYGVSN
HSGTTMGGHYHCLLKRPSPAEWHSFNDSRVTPMSSTHVRSSDAYLLFYGWPAHPHACSRP
PGTPRSLLPGFGPPKNSRKPRDEGRTQAAPVPPGRWRLLFTLG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacgcatggccccgaccccacgagctccaaggtggtgcaggggctcgactggg
ctgcggaacctcggcaatacgtgctacatgaactccatcctgcagtgcctgagcaacacc
aaggagctgcgggattactgcctgcagaaccagtacctgcgggacttcaacaacaacagc
cgcatgcgcaccgcgttcatgtcagagtttgcaaagctgatccagctgttctggacctca
tcccccaatgacagcgtgagtccctccgagttcaagacgcagatccagagatacgcccca
cgctttgttggatacaaccagcaggatgcacaggagttcctgcgcttcctcctggatggg
ctgcacggcgaggtgaaccgcgtgctggtgcggccgcgggccaatgctgacaccttggac
cacttccctgatgatgagaagagccgccagatgtggcggaggtaccaggagcgggaggac
agtcctgttagtgatttcttccttgggcagctgaagagctcactgacctccagtgagtgt
ggctactgctccacagcctttgaccccttctgggacctctccctgcccatccccaagaaa
ggctatggggaagtgaccctgatgcactgcctgcccctcttcaccaaagaggaccttctg
gatggggatgagaaaccgacgtgctgtcgctgcaaagccaggacgcgatgcaccaagaaa
ttcagcatccagaagttccccaagatcctcctgctccacctgaagcgcttctcagaggcc
aggatacgagccagcaagctcaccaccttcgtcgacttcccactgaaggacctggacctg
agggagttcgcctcgcagagctgcaaccacgccgtttacaagctctacggcgtctctaac
cactcgggcaccaccatggggggacactaccactgcctactcaagaggccatctccagcg
gagtggcacagcttcaacgattcccgcgtcacccccatgtcctccacccacgtgcgcagc
agcgatgcctacctgctcttctacggctggccagcccatcctcacgcatgtagccggccc
ccgggcacccctcggagcctcctacctggatttgggccccccaagaacagcagaaagccc
cgagacgagggcaggacccaggcagccccagtgcctccgggccgctggcgtttgcttttt
accctggggtag

DBGET integrated database retrieval system