KEGG   Gallus gallus (chicken): 395780Help
Entry
395780            CDS       T01006                                 

Gene name
APOA4, APOAIV
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
24
AA seq 366 aa AA seqDB search
MSPKAALLLVLLAVAGTRADVSPDQVATVLWRYFTELGSSAKETVDQLQQAEITKQLNTL
LQSNLQSANSYAEELQRRLVPFATELQAQLVQDSQRLKKQIQQELAELQAKLAPYADEVH
QQIGTNIRELQAKLSPYADELRSQVDRGTGELRRALEPFATELREKLQDNADSIQASLGP
YAERLQQQIDSSVEGLKGQLTPLADELKEQVAQSVEGLRKGLSPYAQEVQDGLNRQLQSL
TAQMERAAEELRSRLAASSEEMRAQLSPLAQELQEALRGDAEAMQQRLAPLAQQLDERLA
QTVEAFRQQAAPISETFRQQLVQRLEEMKQKLESGTAGVEDHLDLLEKEVREKVATFLST
TEQAES
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctaaagctgccctcctcttggtgctcctggctgtggcagggacgcgggccgac
gtcagccctgaccaggtggccactgtgctctggaggtacttcaccgagctgggcagcagt
gccaaggagaccgtggaccaactgcagcaagctgagatcaccaagcagctcaacaccctg
ctgcagagcaacctgcagagcgcgaactcatacgccgaggagctgcagcggcgcctggtg
ccctttgccacggagctgcaggcacagctggtgcaggactcacagcggctgaagaagcag
atccagcaggagctggccgagctgcaggccaagctggctccttacgccgacgaggtgcac
cagcagatcggcaccaacatccgcgagctgcaggccaagctgagcccctacgccgatgag
ctgcgctcgcaggtggaccgcggcaccggggagctgcggcgggcgctggagccctttgcc
accgagctgcgggagaagctgcaggacaacgccgacagcatccaggcctctctgggcccc
tacgccgagcggctgcagcagcagatcgacagcagcgtggaggggctgaaggggcagctg
acaccgctggccgacgagctgaaggagcaggtggcacagagcgtggaggggctgcgcaag
gggctcagcccttacgcccaggaggtgcaggacggcctcaaccgacagctgcagagcctc
acggcgcagatggagcgggcggccgaggagctgcgctcccgcctggctgccagctcggag
gagatgcgtgcccagctcagcccgctggcccaggagctgcaggaggcactgcgtggagat
gctgaggccatgcagcagcggctggccccgctggcacagcagctggacgaacgcctggcg
cagacagtggaggcgttccggcagcaggcggcccccatcagcgagaccttccggcagcag
ctggtgcagcggctggaggagatgaagcagaagctggagtcgggcactgctggcgtggag
gaccacctggacctcctggagaaggaggtgcgggagaaggtggccaccttcctcagcacc
acggagcaggcagagagctga

DBGET integrated database retrieval system