KEGG   Gallus gallus (chicken): 395832Help
Entry
395832            CDS       T01006                                 

Gene name
PXN
Definition
(RefSeq) paxillin
  KO
K05760  
paxillin
Organism
gga  Gallus gallus (chicken)
Pathway
VEGF signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    395832 (PXN)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    395832 (PXN)
  Cellular commiunity
   04510 Focal adhesion
    395832 (PXN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
15
AA seq 559 aa AA seqDB search
MDDLDALLADLESTTSHISKRPVFLTEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TVIDPLDQWQPSVSRYGHQQPQSQSPIYSSSAKSSSASVPRDGLSSPSPRASEEEHVYSF
PNKQKSAEPSPTMTSTSLGSNLSELDRLLLELNAVQHNPPSGFSADEVSRSPSLPNVTGP
HYVIPESSSSAGGKAAPPTKEKPKRNGGRGIEDVRPSVESLLDELESSVPSPVPAITVSQ
GEVSSPQRVNASQQQTRISASSATRELDELMASLSDFKFMAQGKAGGSSSPPSTTPKPGS
QLDTMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIG
SRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGVFFGP
EGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFING
SFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMGKKFHPEHFVCAFCLKQLNKGT
FKEQNDKPYCQNCFLKLFC
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggacgacctcgatgccttactggcagacctggaatccaccacctcgcatatctctaag
cgaccggtgtttctaacagaggaaacgccttactcctacccaactggaaaccatacgtac
caggagattgctgtgccaccgccggtgcccccgccgccttccagtgaggccctaaatggc
actgtgattgaccccttagaccagtggcaacccagcgtgtccagatacggccaccagcaa
cctcagtcccagtctccgatatacagctctagtgccaaaagctccagtgcctctgttcct
agagacgggctcagctccccttctccccgtgccagtgaggaggaacacgtgtacagcttc
ccaaacaagcagaagtctgcagaaccatctcccacaatgaccagcacctccctgggcagc
aacctctcggaactggacaggcttctcctggaactgaatgctgttcaacataatcccccc
agtggcttctcagcagatgaagtcagcagaagcccatcactgcccaatgtgaccggacct
cactatgtcatcccagagagcagcagctctgcaggagggaaggctgcaccccctacaaaa
gaaaaaccaaagcggaatggtgggcgtgggattgaagatgtgcgtcccagtgtggagagc
ctgctggatgagctggagagctctgtgccaagcccagtccctgcaatcactgtgagccaa
ggggaggtgagcagcccccagcgtgtcaacgccagtcagcagcagacccgtatctctgct
tcttcagctacacgagaactggatgagctgatggcgtccctctctgactttaagttcatg
gcacaggggaaagccggcggcagcagctccccaccatccaccaccccaaagcctggcagt
cagctggacaccatgctgggaagtctgcagtctgacctgaacaaactgggggtagcgacg
gtcgccaagggtgtgtgcggagcctgcaagaagccgattgctgggcaggtagttacagcc
atggggaagacctggcaccctgagcacttcgtctgcacccactgccaggaggagattgga
tcacggaacttctttgagcgggatgggcagccctactgtgagaaggactatcacaacctc
ttctctcctcgctgctactactgcaatgggccaatccttgataaagtggtgacggctttg
gacaggacgtggcaccctgaacactttttctgtgcccagtgtggagttttctttggacct
gaaggatttcatgagaaggatggcaaagcctattgccgcaaggactactttgacatgttt
gctcccaagtgtggaggctgtgcccgggctatcctggaaaattacatttctgccttaaac
accctgtggcaccctgagtgctttgtctgtcgggaatgtttcacaccgttcatcaacggc
agcttcttcgagcacgacggccagccctactgcgaggtgcattaccacgagcgccgcggc
tcgctgtgctctggctgccagaagcccatcacgggacgctgcatcactgccatgggcaag
aaatttcaccccgaacactttgtctgtgccttctgcctcaagcagctcaacaaaggaacc
ttcaaagaacagaacgacaagccctactgtcagaactgctttctcaaactcttctgttaa

DBGET integrated database retrieval system