KEGG   Gallus gallus (chicken): 395846Help
Entry
395846            CDS       T01006                                 

Gene name
GJA8, Cx45.6, Cx50, connexin-45.6
Definition
(RefSeq) gap junction protein alpha 8
  KO
K07617  
gap junction alpha-8 protein
Organism
gga  Gallus gallus (chicken)
Brite
Transporters [BR:gga02000]
 Other Transporters
  Pores ion channels [TC:1]
   395846 (GJA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 400 aa AA seqDB search
MGDWSFLGNILEQVNEQSTVIGRVWLTVLFIFRILILGTAAELVWGDEQSDFVCNTQQPG
CENVCYDEAFPISHIRLWVLQIIFVSTPSLVYFGHAVHHVRMEEKRKEREEAERRQQAEV
DEEKLPLAPNQNKGNNPDGTKKFRLEGTLLRTYILHIIFKTLFEVGFIVGQYFLYGFRIL
PLYRCGRWPCPNLVDCFVSRPTEKTIFIMFMLVVAAVSLFLNLVEISHLILKRIRRALRR
PAEEQMGEVPEKPLHAIAVSSIPKAKGYKLLEEEKPVSHYFPLTEVGVEPSPLPSAFNEF
EEKIGMGPLEDLSRAFDERLPSYAQAKEPEEEKVKAEEEEEQEEEQQAPQEEPGVKKAEE
EVVSDEVEGPSAPAELATDVRSLSRLSKASSRARSDDLTV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactggagtttcttggggaacattttagagcaggtgaacgagcagtccactgtc
atcgggagagtttggctcacggtgctcttcattttccgcatcctgatcctgggaacagct
gctgaactagtatggggagatgaacagtcagactttgtgtgcaacacccagcaacctggt
tgtgagaacgtctgctatgatgaggccttccccatctcccacatccggctctgggtccta
cagatcatttttgtatccacgccttcgctagtgtactttgggcatgcggtgcaccatgtc
cgcatggaggagaagaggaaagagagggaggaagctgagaggcgtcagcaagctgaggtg
gatgaagagaagctgcccctagctccaaatcaaaacaagggcaacaacccagatgggacc
aagaagtttcgcctggaggggaccctcctgagaacctacatcctccacatcattttcaaa
actctctttgaagtgggattcattgttggccagtatttcctgtatggcttccgcattctc
cccctttaccgctgtgggcggtggccctgtcccaacctagtggactgttttgtctccagg
cccacagagaagaccatctttattatgttcatgctcgtggtggctgctgtgtccctcttc
ctcaacctggtggagatcagccacttgatcctgaaaaggatccggagggctctgagaaga
ccagcagaggagcagatgggggaggtgccagagaagcccctccatgctattgcagtgtcc
tccatcccgaaggccaaaggctacaagctgctagaagaagaaaagccagtgtcccactat
ttccctctcacggaagtaggggttgagcccagtccccttccatcagccttcaatgagttt
gaggagaagattgggatggggccactggaagatctctccagggcatttgatgagaggtta
ccatcgtatgcacaagcgaaggaaccggaagaggagaaggtaaaagcagaggaggaagag
gaacaagaagaggagcagcaagcacctcaggaagagccaggggtgaagaaagcagaggag
gaggtggtgagcgatgaagtggaagggccttcagcacctgctgaacttgccaccgatgtg
agatccctcagcaggctaagtaaagccagcagccgggccaggtcagacgatctgactgta
tga

DBGET integrated database retrieval system