KEGG   Gallus gallus (chicken): 395865Help
Entry
395865            CDS       T01006                                 

Gene name
LEF1, LEF-1
Definition
(RefSeq) lymphoid enhancer binding factor 1
  KO
K04492  
lymphoid enhancer-binding factor 1
Organism
gga  Gallus gallus (chicken)
Pathway
Wnt signaling pathway
Adherens junction
Melanogenesis
Module
Wnt signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    395865 (LEF1)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    395865 (LEF1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    395865 (LEF1)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    395865 (LEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
4
AA seq 369 aa AA seqDB search
MPQLPGAGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNES
EIAPGSGGHEVSRQTPAQDSYHDKGREHPEEGKHPDGGLYSKGPSYSGYSGYIMMPNMNN
DPYMPNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVSSKQ
GMSRHPPAPDIPTFYPLSPGGVGQITPPLGWFSHHMIPGPPGPHTTGIPHPAIVTPQVKQ
EHPHNDSELMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAIN
QILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGT
GPRMTAAYI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctgccgggggccgggggcggcgggggggacccggagctctgcgccaccgac
gagatgatccccttcaaggacgaaggggacccccagaaggagaagatcttcgccgagatc
agccaccccgaggaagagggcgacctggccgacatcaagtcctcgctggtcaacgagtcc
gagatcgcgcccggctccggcgggcacgaggtttccaggcagactccagcgcaggattcc
taccatgacaagggcagggagcaccccgaggaaggaaagcatcccgacggcggcttgtac
agcaagggaccatcgtactctggttactcggggtatatcatgatgccaaatatgaacaac
gacccgtacatgcctaacggatctctgtcgccacccatccccagaacatccaacaaggtg
ccagtggtacagccttctcacgcagttcaccccctcaccccccttatcacctacagcgat
gagcacttttccccaggctcccacccatctcacatcccctctgacgtcagctccaagcaa
ggcatgtccaggcatcctccagctcctgatatccctaccttctatcccttgtctccaggg
ggggttggacagataacaccacctcttggctggttttcacatcacatgattcctggtcct
ccaggccctcacacaactggaatccctcacccagctattgtaacacctcaagtaaaacaa
gaacatccgcacaacgacagtgagctaatgcatgtgaagcctcagcacgaacagaggaaa
gaacaagagccaaaaagacctcatattaagaaacctctgaatgctttcatgttgtacatg
aaagaaatgagagcgaacgttgtagcagagtgtactctgaaagaaagcgcagctatcaac
cagattcttggcagaaggtggcatgctctctctcgtgaagaacaagcaaaatattatgaa
ctagctcgtaaagaaaggcagctacacatgcagctttatccaggctggtctgcaagagac
aactacgggaagaagaagaagaggaagagagaaaagttgcaggaatcagcatcaggtaca
ggccccagaatgacagctgcctacatctga

DBGET integrated database retrieval system