KEGG   Gallus gallus (chicken): 395868Help
Entry
395868            CDS       T01006                                 

Gene name
TLX1, TLX-1
Definition
(RefSeq) T-cell leukemia homeobox 1
  KO
K09340  
T-cell leukemia homeobox protein 1
Organism
gga  Gallus gallus (chicken)
Brite
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, H2.0
    395868 (TLX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
6
AA seq 297 aa AA seqDB search
MEHLGAHHLHQGQAEPISFGIDQILNTSEPGSCMVSHPRLQDSADYGLGCIVGSAYNTVT
GGYGASGGGAGAYGGTSCSMGALPGSYNVNMAVSMNGNALSSAGGVIRVPAHRPVAGGVH
QPLSAAVPPVNGMNSLTGLTFPWMESNRRYTKDRFTGHPYQNRTPPKKKKPRTSFTRLQI
CELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANR
ILMQLQQEAFQKTINQPIQADPICVHNSSLFALQNLQPWSDDSTKITSVTTVASACE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggagcacctcggggctcaccacctgcaccaaggccaagccgagcccatcagcttcggc
atcgaccagatcctcaacacgtcggagccgggaagctgcatggtgtcccacccgcggctg
caggactcggcggattacggcctgggttgcatcgtgggcagcgcctacaacacggtcacc
ggcggctacggggcgagcggcggcggggccggagcctacggcggcacctcgtgcagtatg
ggagccttgcccggctcctacaacgtgaacatggcggtgagcatgaacggcaacgctttg
agctcggccgggggggtgatccgcgtcccggcccaccgccccgtagccggcggcgtgcac
cagcccctctccgccgccgtgccgccggtgaacggcatgaacagtctgacggggctcacc
ttcccctggatggagagcaacaggcggtacacaaaggacaggttcacaggtcacccctac
cagaaccgcacgccccccaagaagaagaagccgcgcacgtccttcacccgcctgcagatc
tgtgagctggagaagcgcttccaccggcagaagtacctggcctctgctgagcgtgcagcc
ctggccaaggccctcaagatgacggacgcccaggtgaagacgtggttccagaaccggcgc
accaagtggaggaggcagacagcggaggagcgggaggccgagaggcagcaagcgaaccgc
atcctcatgcagctgcagcaggaggccttccaaaaaaccatcaaccagcccatccaggcc
gaccccatctgcgtgcacaactcctctctcttcgccctgcagaacctccagccctggtct
gacgactccaccaagatcaccagcgtcaccaccgtcgcctcygcctgcgaataa

DBGET integrated database retrieval system