KEGG   Gallus gallus (chicken): 395876Help
Entry
395876            CDS       T01006                                 

Gene name
F10
Definition
(RefSeq) coagulation factor X (EC:3.4.21.6)
  KO
K01314  
coagulation factor X [EC:3.4.21.6]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.6  coagulation factor Xa
     395876 (F10)
Peptidases [BR:gga01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   395876 (F10)
Cell adhesion molecules and their ligands [BR:gga04516]
 2. Integrin Family
  Beta2 integrins
   CR3, Mac-1
    ITGB2; integrin beta 2 [KO:K06464]
     395876 (F10)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
   395876 (F10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 475 aa AA seqDB search
MAGRLLLLLLCAALPDELRAEGGVFIKKESADKFLERTKRANSFLEEMKQGNIERECNEE
RCSKEEAREAFEDNEKTEEFWNIYVDGDQCSSNPCHYGGQCKDGLGSYTCSCLDGYQGKN
CEFVIPKYCKINNGDCEQFCSIKKSVQKDVVCSCTSGYELAEDGKQCVSKVKYPCGKVLM
KRIKRSVILPTNSNTNATSDQDVPSTNGSILEEVFTTTTESPTPPPRNGSSITDPNVDTR
IVGGDECRPGECPWQAVLINEKGEEFCGGTILNEDFILTAAHCINQSKEIKVVVGEVDRE
KEEHSETTHTAEKIFVHSKYIAETYDNDIALIKLKEPIQFSEYVVPACLPQADFANEVLM
NQKSGMVSGFGREFEAGRLSKRLKVLEVPYVDRSTCKQSTNFAITENMFCAGYETEQKDA
CQGDSGGPHVTRYKDTYFVTGIVSWGEGCARKGKYGVYTKLSRFLRWVRTVMRQK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggccggccgcctgctgctcctgctgctctgcgcggcgttgccggacgagctccgggct
gaaggaggcgtgttcatcaagaaagaaagtgccgacaagttcttggaaagaacaaaacgt
gccaactcttttttagaagaaatgaagcaaggcaatattgaaagagaatgcaacgaggag
cgctgctcaaaagaagaggcaagagaagcctttgaagacaatgagaaaactgaggaattc
tggaatatctacgtagatggcgaccagtgcagctcaaatccatgtcactatggtggacaa
tgtaaagatggacttggttcctacacttgctcctgtttggatggttatcaaggcaagaac
tgtgaatttgtcataccgaagtactgcaaaataaacaatggtgactgtgagcagttctgc
agcatcaaaaaaagcgtgcagaaggatgtcgtgtgttcctgtacaagtgggtatgagctg
gcagaagatggcaaacagtgtgtttcaaaagtaaagtacccatgtggaaaagttctcatg
aaaagaattaaaaggtctgtcatcttacccactaatagtaataccaatgcaactagtgat
caagatgtcccctccacgaatggatcaattctggaggaggtctttactactaccacagaa
agcccaactccccctcctcgcaacggatcgagtatcacagatccaaatgtcgataccagg
atagtaggtggggatgagtgtcgtcctggtgaatgcccatggcaggccgtgctgataaat
gagaagggggaagagttttgtggcggaactatactgaatgaagatttcatccttactgct
gctcattgcataaaccaatccaaagagatcaaagttgttgttggtgaagtggatagagaa
aaggaagaacattctgaaacaacacatactgcagaaaaaatatttgttcactctaagtac
atcgccgagacttatgataatgacatagccctcataaagctgaaggaacccatacagttt
tcggagtatgttgtcccagcatgcctcccacaagcagactttgctaatgaagtgctgatg
aaccaaaagtctgggatggttagtggctttgggcgtgaatttgaagctggacggctttcc
aaaagactgaaagtgctcgaagtcccctatgttgataggagcacttgcaagcagtccact
aactttgcaataacagaaaacatgttctgtgctggttatgaaacagagcaaaaggatgct
tgtcaaggagacagtggaggcccccatgtaaccagatataaggatacttactttgttact
ggaattgttagctggggagaaggatgtgcaaggaagggcaaatacggtgtatataccaag
ctgtccagattcttacgttgggtaaggacagtcatgaggcaaaagtag

DBGET integrated database retrieval system