KEGG   Gallus gallus (chicken): 395910Help
Entry
395910            CDS       T01006                                 

Gene name
PADI3, cPAD3
Definition
peptidyl arginine deiminase, type III (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     395910 (PADI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
21
AA seq 672 aa AA seqDB search
MAQQRRVQLCTQRPTSTVCVLGTELSLDIQGSAPKDAIAFHVQGTPGVKVYVVHETQSVK
LPSSVTRWPLATGTEVLLTMEAISKDVGDEKVRISYFGEASGVPVGRAMLYLTCVDISLD
ADTGRNGSVSKTLVDKATWTWGPDGHGAILLVNCDRDDPKSRLMGDSSEPQSQLTDNRDT
VVCSYEDLKDMSQMVLRTRGPRTIFTGHGLVLHVNFSDADKVGVFYGGNSIALEEYKHVL
GGEKLAYAVKPSQHQEESIFYVEGLAFPDVSFSGLVAFHVTLLESPEKGLLETPIFTDTV
VFRMAPWIMTPNTLAPLEVFVCSVKDNEDFVAAVSALAEEAKCPVTICPLPENRNDRWIQ
DEVEFGYVQAPHKMFPVVLDSPRDRGLKDFPVRSILGPDFGYVAQETPENTSSLDSFGNL
EVSPPVTVRSKEYPLGRILIGSSFPRFGGRRMAKAVRNFLAAQRVQAPVELFSDWLQVGH
VDEFLSFIPAPDRKGFRLLLASPSACYQLLREKQEMGYGEATMFQGLHGVPKPSISEILG
NEALRKFNAYAQSCISWNRDILKRELGLAEQDIIDIPQLFQADHQARAVAYFPDMVNMLV
LGRHLGIPKPFGPLVDGQCCLEERVRALLQPLGLSCTFINDYFSYHKLAGEVHCGTNVRR
KPFAFKWWRMVP
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcagcgtcgtgttcagctctgcacgcagcggcccaccagcaccgtctgtgtg
ctgggcactgagctgtccttggacatccaggggtcagcacccaaggatgccatcgccttc
catgtgcagggcacacctggtgtgaaagtctatgtggtacatgagacacagagtgtgaag
ctgccctccagcgtcacccgctggccgttggccactggcactgaggtgctgctcaccatg
gaggcaatcagcaaggacgtgggggatgagaaggtcaggatttcctattttggtgaagcc
agtggggtgccggtgggccgagccatgctgtacctcacctgcgtggacatctcactggat
gctgacactggtcgcaacgggtcagtcagcaagacgttggtggacaaggccacatggaca
tggggtcctgatggtcatggtgccattctgctggtcaactgtgaccgtgatgaccccaaa
agccggttgatgggtgacagcagcgaaccccaaagtcagctgacagataatcgtgacact
gttgtgtgctcctatgaagacctgaaggacatgtcacagatggttctgcggacccgtgga
ccacgcaccatcttcactggccatggcctcgtcctgcacgtgaatttcagtgatgctgat
aaagttggcgtgttctacggaggcaacagcattgcactggaggagtacaagcacgtgctg
ggtggtgagaagctcgcctatgctgtgaagcccagccagcaccaggaggaaagcatcttc
tacgtggaggggcttgccttccctgacgtcagcttttcagggctggttgcattccatgtc
acactgctggagagccctgagaagggcttgctggagacaccaattttcacggacacggtg
gtgttccgcatggctccatggatcatgacacccaacacgttggcaccattggaggtcttt
gtgtgcagcgtgaaggacaatgaggactttgtggcggctgtcagcgcactggctgaagaa
gccaagtgcccagtaaccatttgcccactgcccgagaaccgcaatgaccgctggatccag
gatgaagtggagtttggctatgtgcaagcacctcataaaatgttcccagtggtcttggac
tcacctcgtgaccggggcctgaaggacttccctgtcaggagcatcctgggccctgatttt
ggctatgtggctcaagaaacaccagagaacacctccagcctcgactccttcggcaacctg
gaggtcagcccaccagtgacagtgcgcagcaaggagtacccgctgggccgcatcctcatt
ggcagcagcttccccaggtttggcggccggcgcatggccaaagcagtgcggaatttcctc
gctgctcagcgtgtccaggcgcctgtggagctcttctcagactggctgcaggtcgggcat
gttgatgagttcctcagcttcatccctgcacctgatcggaagggctttaggctgctgctg
gccagccccagtgcctgctaccagctgctcagggagaagcaggagatgggctacggggaa
gcgacaatgttccaggggctgcatggtgtgcccaagccgagcatcagcgagatcctggga
aatgaagcactgcgcaagttcaatgcctatgcgcagagctgcatcagttggaatagggac
atcctgaagcgggagctggggctggctgagcaggacatcatcgacatcccgcagctcttt
caagctgatcaccaagccagagccgtagcctatttccctgacatggtgaacatgctggtg
ctgggcagacacctgggcatccccaagccatttggaccgctggtggacgggcagtgctgc
ctggaggagcgggtgcgggcactgctgcagcccctggggctctcttgcaccttcatcaac
gattacttctcctaccacaagcttgctggagaggtgcactgcggcaccaatgtccgccgc
aaaccctttgccttcaagtggtggcggatggtgccctga

DBGET integrated database retrieval system