KEGG   Gallus gallus (chicken): 395926Help
Entry
395926            CDS       T01006                                 

Definition
pepsinogen (EC:3.4.23.1)
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
26
AA seq 383 aa AA seqDB search
MRSLALLCAVLALSDGITRLPLERGKKLREILREKGLLHHFLQHHRYDIGTKFPHAFPDV
LTVVTEPLLNTLDMEYYGTISIGTPPQDFTVVFDTGSSNLWVPSVSCTSPACQSHQMFNP
SQSSTYKSTGQNLSIHYGTGDMEGTVGCDTVTVASLMDTNQLFGLSTSEPGQFFVYVKFD
GILGLGYPSLAADGITPVFDNMVNESLLEQNLFSVYLSREPMGSMVVFGGIDESYFTGSI
NWIPVSYQGYWQISMDSIIVNKQEIACSSGCQAIIDTGTSLVAGPASDINDIQSAVGANQ
NTYGEYSVNCSHILAMPDVVFVIGGIQYPVPALAYTEQNGQGTCMSSFQNSSADLWILGD
VFIRVYYSIFDRANNRVGLAKAI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcgatccctggcgctcctgtgcgcggtccttgctctctccgatggcatcaccaggctg
cccttggaaagggggaagaagctgagagagatcctcagggagaagggcttgctgcaccac
ttcctccagcatcaccgctacgacatcggcaccaaattcccacatgcttttcctgatgtg
ctcaccgtggtcaccgaacccctgctgaacaccctggacatggaatactatgggaccatc
tccattggcaccccaccgcaggacttcactgtggtcttcgacaccggctcctccaacctc
tgggttccctctgtctcctgcaccagcccagcctgccaaagccatcagatgtttaaccca
tcgcagtcctccacctacaaaagcacagggcagaacctgtccattcactatggcactggt
gacatggagggcaccgtgggctgcgacaccgtcactgttgcatcactgatggacaccaac
cagctctttggcttgagtacctctgagcctggccaattctttgtctatgtcaaatttgat
gggatcttgggcttgggctacccaagtttagcagctgatggaatcactccggtctttgat
aacatggtgaatgagagcttgctggagcagaacctcttctcagtctatctatcccgtgag
ccaatggggagcatggtcgtcttcgggggaatcgatgagtcctatttcactggctccatc
aactggattcctgtctcttaccaaggatactggcagatctccatggacagcatcattgtg
aacaagcaggagattgcgtgcagcagcggctgccaggccatcattgacactggcacatcc
ctcgtggccgggccggcctcggacattaacgacatccaaagcgcagtcggggccaatcag
aacacgtatggagagtacagtgtgaactgcagccacatccttgccatgcctgacgttgtc
tttgtcatcggtggcattcagtatcccgtgcctgccttggcttacaccgagcagaatggc
caaggaacctgcatgagcagcttccagaacagctctgcagacctctggatcttgggagac
gtcttcatcagagtgtactacagcatcttcgaccgggccaacaaccgtgttggactggcc
aaggctatttag

DBGET integrated database retrieval system