KEGG   Gallus gallus (chicken): 395929Help
Entry
395929            CDS       T01006                                 

Gene name
HADHA
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00062  Fatty acid elongation
gga00071  Fatty acid degradation
gga00280  Valine, leucine and isoleucine degradation
gga00310  Lysine degradation
gga00380  Tryptophan metabolism
gga00410  beta-Alanine metabolism
gga00640  Propanoate metabolism
gga00650  Butanoate metabolism
gga01040  Biosynthesis of unsaturated fatty acids
gga01100  Metabolic pathways
gga01200  Carbon metabolism
gga01212  Fatty acid metabolism
Module
gga_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
gga_M00085  Fatty acid biosynthesis, elongation, mitochondria
gga_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    395929 (HADHA)
   00650 Butanoate metabolism
    395929 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    395929 (HADHA)
   00071 Fatty acid degradation
    395929 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    395929 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    395929 (HADHA)
   00310 Lysine degradation
    395929 (HADHA)
   00380 Tryptophan metabolism
    395929 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    395929 (HADHA)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     395929 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     395929 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 395929
NCBI-ProteinID: NP_990387
CGNC: 12383
Ensembl: ENSGALG00000016536
UniProt: F1NI29
Position
3
AA seq 770 aa AA seqDB search
MAAAVRAIGSLGRFAAAAKYCPPRRPAAEGYACRNVSTSTALQARTHVSYDIKGDVAVVR
FNTPNSKVNTLSKQLNAEFTEVMNEIWTNEAVKSAVLISSKPGSFIAGADIDMIAACKTS
QEVTQLSQEGQKMLEKIEQSPKPIVAAISGSCLGGGLEVAIACHYRIATKDRKTILGTPE
VLLGLLPGAGATQRLPKMVGLPAAFDMMLTGRNINADRAKKMGLVDQLVDPLGPGVKPPE
ARTIEYLEEVAIGFARGLANKTVSAKRSKGLVQRITDYAMALPFVRQQVYKTVENKVQKQ
TKGLYPAPLKIIEVVKAGLDQGHDTGYLTESQSFGHLAMTNESKALIGLYHGQVRCKKNK
FGTPQREVKTLAVLGAGLMGAGIAQVSVDKGLKTILKDTMQQGLDRGQQQVFKGLNGKVK
KKSLTSFERDSILSNMTAQLDYKGFEKADMVIEAVFEDINIKHKVLKEVEAVIPPHCIFA
SNTSALPINQIAAVSQRPEKVIGMHYFSPVDKMQLLEIITTDKTSQDTAASAVAVGLKQG
KVVIVVKDGPGFYTTRCLGPMLAEVGRVLQEGIDPKKVDAISTAFGFPVGAATLIDEVGV
DVATHVAEDLGKAFGERFGGGSIGLFKLMVQKGFLGRKAGKGFYIYQEGVKNRSLNSGMD
EILAQFKLPAKPEVCTDEDIQMRLVTRFVNEAAMCLQEGILSNPVEGDIGAVFGLGFPPC
LGGPFRYADSYGAKQLVDKLRKYEAVYGSQFTPCQLLLDYANSPGKKFHQ
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcagtgcgcgctatcggcagcttggggcgcttcgcggccgccgctaagtat
tgcccgccccgccgtccggcggctgagggctacgcttgccgtaatgtctccacctccact
gctcttcaggctagaacccacgtgagctacgatatcaaaggagatgttgctgttgtccgc
ttcaacacaccaaattcaaaggtgaacactctatccaaacaattgaatgcagagtttact
gaagtaatgaatgagatatggaccaatgaagcagtcaaaagtgccgtcctcatctcttca
aagccaggttctttcattgctggagcagatattgacatgattgcagcctgcaagacttct
caggaagtgactcagctctctcaggaaggacagaagatgctagaaaagattgagcagtct
ccaaagcccatagttgctgccatcagtggttcctgcctgggaggaggactggaggttgcc
attgcctgtcactacagaatagcaacaaaggacaggaaaacaatcttgggaacacctgaa
gtattactgggactcctgccaggggcaggggcaactcagaggctgccaaagatggtggga
cttcctgctgcctttgatatgatgctgactgggaggaacatcaatgctgacagagcaaag
aagatgggtctggttgaccaactggtggacccactagggccaggtgtgaagcctccagaa
gcacgaacaattgagtacttggaggaggtcgcaattggctttgccagagggttagccaac
aagactgtgtctgccaagagatcaaaaggactagtacagaggataacagactatgcaatg
gctcttccatttgtgaggcagcaagtctacaagacggtggagaacaaagttcagaagcaa
accaaaggactgtaccctgctccactgaaaatcattgaggttgtgaaggctggtcttgac
caggggcatgacactggatacctcactgaatcccagagttttggccaccttgcaatgacc
aatgaatccaaggcactgattggactttaccacgggcaggtgcgctgcaagaagaacaag
tttggaacacctcagcgagaggtcaagaccctggcagtgctgggagcagggctcatggga
gctgggattgcccaggtttcagtggataaagggctgaaaaccattctgaaggacacaatg
cagcaaggcttggacagaggacagcagcaagtcttcaaggggctgaatggcaaggtgaag
aagaagagtctaacatcgtttgagagggactctattctcagcaacatgacagctcagcta
gactacaagggctttgagaaagcagacatggtgatcgaggctgtgtttgaggacattaac
atcaagcacaaagtgctgaaggaagtggaggcggtgatccctcctcactgtatctttgcc
agtaacacgtctgccctcccaatcaaccaaattgctgctgttagccagaggccagagaag
gtgattgggatgcactacttctcccctgttgacaaaatgcagctgctggaaatcatcact
acagacaaaacatcccaggacacagctgcttctgccgttgctgttggcctcaaacaaggc
aaagtcgtcattgtggtaaaggatggacctggtttctacaccacgaggtgcctggggcca
atgctggcagaagtggggagagttctccaggagggcattgacccaaagaaagtagatgcc
atctctacagcctttggctttcctgtgggtgctgccacactgatcgatgaggttggtgtg
gacgtggccacacacgtggctgaggatcttggcaaggccttcggggagcgctttggaggc
ggcagcatcggtttgttcaagctcatggtgcagaagggcttcttaggccgcaaggcaggg
aagggcttctacatttaccaggagggggtgaaaaacaggagcttgaactctggcatggat
gagatcttggcacagttcaagttgccagctaaacctgaagtctgtactgatgaggacatc
cagatgcgcttggtgacgaggtttgtgaatgaggcagccatgtgcctgcaggaagggatc
ctcagcaaccctgtggagggagacattggtgctgtgtttggtttgggcttcccaccttgc
ttgggaggtcccttcaggtatgcggactcctatggtgccaagcagctggtggacaagctg
cggaagtacgaggccgtctatggcagccagttcacaccgtgccagctgctgctggactat
gccaacagcccaggcaagaagttccaccagtga

DBGET integrated database retrieval system