KEGG   Gallus gallus (chicken): 395929Help
Entry
395929            CDS       T01006                                 

Gene name
HADHA
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
  KO
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
gga  Gallus gallus (chicken)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    395929 (HADHA)
   01212 Fatty acid metabolism
    395929 (HADHA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    395929 (HADHA)
   00650 Butanoate metabolism
    395929 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    395929 (HADHA)
   00071 Fatty acid degradation
    395929 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    395929 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    395929 (HADHA)
   00310 Lysine degradation
    395929 (HADHA)
   00380 Tryptophan metabolism
    395929 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    395929 (HADHA)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     395929 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     395929 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
3
AA seq 770 aa AA seqDB search
MAAAVRAIGSLGRFAAAAKYCPPRRPAAEGYACRNVSTSTALQARTHVSYDIKGDVAVVR
FNTPNSKVNTLSKQLNAEFTEVMNEIWTNEAVKSAVLISSKPGSFIAGADIDMIAACKTS
QEVTQLSQEGQKMLEKIEQSPKPIVAAISGSCLGGGLEVAIACHYRIATKDRKTILGTPE
VLLGLLPGAGATQRLPKMVGLPAAFDMMLTGRNINADRAKKMGLVDQLVDPLGPGVKPPE
ARTIEYLEEVAIGFARGLANKTVSAKRSKGLVQRITDYAMALPFVRQQVYKTVENKVQKQ
TKGLYPAPLKIIEVVKAGLDQGHDTGYLTESQSFGHLAMTNESKALIGLYHGQVRCKKNK
FGTPQREVKTLAVLGAGLMGAGIAQVSVDKGLKTILKDTMQQGLDRGQQQVFKGLNGKVK
KKSLTSFERDSILSNMTAQLDYKGFEKADMVIEAVFEDINIKHKVLKEVEAVIPPHCIFA
SNTSALPINQIAAVSQRPEKVIGMHYFSPVDKMQLLEIITTDKTSQDTAASAVAVGLKQG
KVVIVVKDGPGFYTTRCLGPMLAEVGRVLQEGIDPKKVDAISTAFGFPVGAATLIDEVGV
DVATHVAEDLGKAFGERFGGGSIGLFKLMVQKGFLGRKAGKGFYIYQEGVKNRSLNSGMD
EILAQFKLPAKPEVCTDEDIQMRLVTRFVNEAAMCLQEGILSNPVEGDIGAVFGLGFPPC
LGGPFRYADSYGAKQLVDKLRKYEAVYGSQFTPCQLLLDYANSPGKKFHQ
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcagtgcgcgctatcggcagcttggggcgcttcgcggccgccgctaagtat
tgcccgccccgccgtccggcggctgagggctacgcttgccgtaatgtctccacctccact
gctcttcaggctagaacccacgtgagctacgatatcaaaggagatgttgctgttgtccgc
ttcaacacaccaaattcaaaggtgaacactctatccaaacaattgaatgcagagtttact
gaagtaatgaatgagatatggaccaatgaagcagtcaaaagtgccgtcctcatctcttca
aagccaggttctttcattgctggagcagatattgacatgattgcagcctgcaagacttct
caggaagtgactcagctctctcaggaaggacagaagatgctagaaaagattgagcagtct
ccaaagcccatagttgctgccatcagtggttcctgcctgggaggaggactggaggttgcc
attgcctgtcactacagaatagcaacaaaggacaggaaaacaatcttgggaacacctgaa
gtattactgggactcctgccaggggcaggggcaactcagaggctgccaaagatggtggga
cttcctgctgcctttgatatgatgctgactgggaggaacatcaatgctgacagagcaaag
aagatgggtctggttgaccaactggtggacccactagggccaggtgtgaagcctccagaa
gcacgaacaattgagtacttggaggaggtcgcaattggctttgccagagggttagccaac
aagactgtgtctgccaagagatcaaaaggactagtacagaggataacagactatgcaatg
gctcttccatttgtgaggcagcaagtctacaagacggtggagaacaaagttcagaagcaa
accaaaggactgtaccctgctccactgaaaatcattgaggttgtgaaggctggtcttgac
caggggcatgacactggatacctcactgaatcccagagttttggccaccttgcaatgacc
aatgaatccaaggcactgattggactttaccacgggcaggtgcgctgcaagaagaacaag
tttggaacacctcagcgagaggtcaagaccctggcagtgctgggagcagggctcatggga
gctgggattgcccaggtttcagtggataaagggctgaaaaccattctgaaggacacaatg
cagcaaggcttggacagaggacagcagcaagtcttcaaggggctgaatggcaaggtgaag
aagaagagtctaacatcgtttgagagggactctattctcagcaacatgacagctcagcta
gactacaagggctttgagaaagcagacatggtgatcgaggctgtgtttgaggacattaac
atcaagcacaaagtgctgaaggaagtggaggcggtgatccctcctcactgtatctttgcc
agtaacacgtctgccctcccaatcaaccaaattgctgctgttagccagaggccagagaag
gtgattgggatgcactacttctcccctgttgacaaaatgcagctgctggaaatcatcact
acagacaaaacatcccaggacacagctgcttctgccgttgctgttggcctcaaacaaggc
aaagtcgtcattgtggtaaaggatggacctggtttctacaccacgaggtgcctggggcca
atgctggcagaagtggggagagttctccaggagggcattgacccaaagaaagtagatgcc
atctctacagcctttggctttcctgtgggtgctgccacactgatcgatgaggttggtgtg
gacgtggccacacacgtggctgaggatcttggcaaggccttcggggagcgctttggaggc
ggcagcatcggtttgttcaagctcatggtgcagaagggcttcttaggccgcaaggcaggg
aagggcttctacatttaccaggagggggtgaaaaacaggagcttgaactctggcatggat
gagatcttggcacagttcaagttgccagctaaacctgaagtctgtactgatgaggacatc
cagatgcgcttggtgacgaggtttgtgaatgaggcagccatgtgcctgcaggaagggatc
ctcagcaaccctgtggagggagacattggtgctgtgtttggtttgggcttcccaccttgc
ttgggaggtcccttcaggtatgcggactcctatggtgccaagcagctggtggacaagctg
cggaagtacgaggccgtctatggcagccagttcacaccgtgccagctgctgctggactat
gccaacagcccaggcaagaagttccaccagtga

DBGET integrated database retrieval system