KEGG   Gallus gallus (chicken): 395983Help
Entry
395983            CDS       T01006                                 

Gene name
MAPK9, JNK2-ALPHA1
Definition
mitogen-activated protein kinase 9 (EC:2.7.11.24)
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    395983 (MAPK9)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    395983 (MAPK9)
   04012 ErbB signaling pathway
    395983 (MAPK9)
   04310 Wnt signaling pathway
    395983 (MAPK9)
   04068 FoxO signaling pathway
    395983 (MAPK9)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    395983 (MAPK9)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    395983 (MAPK9)
   04621 NOD-like receptor signaling pathway
    395983 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    395983 (MAPK9)
  Endocrine system
   04910 Insulin signaling pathway
    395983 (MAPK9)
   04920 Adipocytokine signaling pathway
    395983 (MAPK9)
   04912 GnRH signaling pathway
    395983 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    395983 (MAPK9)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    395983 (MAPK9)
   05164 Influenza A
    395983 (MAPK9)
   05168 Herpes simplex infection
    395983 (MAPK9)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     395983 (MAPK9)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   395983 (MAPK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
13
AA seq 382 aa AA seqDB search
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESDRDKLKTSQARDLLSK
MLVVDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSAQMQQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagtaaatgcgatagtcagttttacagtgttcaagttgcagattcaacattc
actgtactaaaacgctaccagcaattgaagcccataggatcaggggcacagggcattgtt
tgtgctgcgttcgatacagtccttgggataaacgttgctgtaaagaagttgagtcgtcct
tttcagaatcaaacccacgcaaaaagagcttacagagagcttgttcttttaaaatgtgtc
aatcacaaaaatataattagtttattaaacgtatttacaccgcagaagtcactagaagaa
tttcaggatgtatatttggttatggaactgatggatgccaacttgtgccaagttattcat
atggaattggatcatgaacgaatgtcttatctcctttaccagatgctatgtggtatcaaa
catctccactcagctggtatcatccacagagatttgaaacccagcaacatagtagtaaaa
tcagattgtacactcaaaatccttgattttggactggcaagaacagcgtgtactaatttt
atgatgacgccatatgtagtaacacgatattacagagcgccagaggttatccttggaatg
ggatataaagagaatgttgatatctggtcagttggttgcatcatgggagaattggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcaatggaataaagtaattgagcaa
ctaggaacgccctcagcagaattcatgaagaaactacagcctacagtgaggaattatgta
gaaaacaggccaaaatatccaggtattaaatttgaagagctcttcccagactggatattt
ccatcagaatctgaccgtgacaagttaaaaaccagtcaagctagagatttattatcaaag
atgctcgtagtagatccagacaagagaatttccgtagatgaggccttacgtcatccctat
attacggtctggtatgatccagctgaagcagaagctcctccacctcaaatttatgatgca
caactggaagagagagaacatgcaattgaagaatggaaagaattaatatacaaagaagta
atggattgggaagaaagaagcaagaatggtgtggtaaaagatcagccctcagcacagatg
cagcagtga

DBGET integrated database retrieval system