KEGG   Gallus gallus (chicken): 396019Help
Entry
396019            CDS       T01006                                 

Gene name
PPP1CB
Definition
(RefSeq) protein phosphatase 1 catalytic subunit beta
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04510  Focal adhesion
gga04810  Regulation of actin cytoskeleton
gga04910  Insulin signaling pathway
gga05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    396019 (PPP1CB)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    396019 (PPP1CB)
   04218 Cellular senescence
    396019 (PPP1CB)
  Cellular community - eukaryotes
   04510 Focal adhesion
    396019 (PPP1CB)
  Cell motility
   04810 Regulation of actin cytoskeleton
    396019 (PPP1CB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    396019 (PPP1CB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    396019 (PPP1CB)
   04270 Vascular smooth muscle contraction
    396019 (PPP1CB)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    396019 (PPP1CB)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     396019 (PPP1CB)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     396019 (PPP1CB)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     396019 (PPP1CB)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     396019 (PPP1CB)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    396019 (PPP1CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 396019
NCBI-ProteinID: NP_990453
CGNC: 49609
Ensembl: ENSGALG00000010026
UniProt: P62207
Position
3
AA seq 327 aa AA seqDB search
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcggatggggagctgaacgtggacagcctcatcacccggctgctggaagtacgagga
tgtcgtcctgggaagattgttcaaatgacagaagcagaagttcggggcctgtgcataaaa
tcacgagaaatatttcttagccagcctattctcctggaactagaggcaccgctgaaaatc
tgtggtgatattcatggtcagtatacagatttgcttagactgtttgaatatggaggattc
ccaccagaagcgaattatcttttccttggagattatgtggacagaggcaaacaatctctg
gaaacaatttgcctacttctggcatataaaatcaagtacccggagaacttctttctctta
agaggaaatcatgagtgcgctagcatcaaccggatctatggattctatgatgaatgtaag
cggaggtttaatattaagctctggaagaccttcacagactgttttaattgtctgcctatt
gcagccattgtggatgagaagatcttctgctgtcatggaggactgtctccagatctccag
tcaatggagcagatccggagaattatgagacctacagatgttcctgacacaggcttacta
tgtgacctgctgtggtctgacccagacaaagatgtgcaaggttggggtgaaaatgatcgt
ggggtctcttttactttcggtgctgatgtggtcagtaaatttctgaatcgtcatgatttg
gatttaatctgtcgagctcaccaggtggttgaagatggatacgaattctttgctaaacgg
cagttggtcaccctattctcagctccaaattattgtggagagtttgacaatgcaggtggc
atgatgagtgtggacgaaactctgatgtgttcctttcagatattgaagccatctgaaaag
aaagccaagtaccagtatggtggactgaattctgggcgtccagtcactccacctcgcaca
gctaatcctccgaagaagaggtga

DBGET integrated database retrieval system