KEGG   Gallus gallus (chicken): 396027Help
Entry
396027            CDS       T01006                                 

Gene name
RELA
Definition
v-rel reticuloendotheliosis viral oncogene homolog A (avian)
Orthology
K04735  
transcription factor p65
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Apoptosis
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Adipocytokine signaling pathway
Salmonella infection
Influenza A
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:gga04010]
Cellular Processes; Cell growth and death; Apoptosis [PATH:gga04210]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:gga04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:gga04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:gga04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:gga04623]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:gga04920]
Human Diseases; Infectious diseases; Salmonella infection [PATH:gga05132]
Human Diseases; Infectious diseases; Influenza A [PATH:gga05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:gga05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
Un
AA seq 558 aa AA seqDB search
MEPADLLPLYLQPEWGEQEPGGATPFVEILEQPKQRGMRFRYKCEGRSAGSIPGEHSTDS
ARTHPTIRVNHYRGPGRVRVSLVTKDPPHGPHPHELVGRHCQHGYYEAELSPERCVHSFQ
NLGIQCVKKRELEAAVAERIRTNNNPFNVPMEERGAEYDLSAVRLCFQVWVNGPGGLCPL
PPVLSQPIYDNRAPSTAELRILPGDRNSGSCQGGDEIFLLCDKVQKEDIEVRFWAEGWEA
KGSFAAADVHRQVAIVFRTPPFRERSLRHPVTVRMELQRPSDRQRSPPLDFRYLPHQGDL
QCIEEKRKRTRDTFRAFVQRAPLPGLEPNPEPRPPRRIAVPSRPPPAPQQPPSMVGAPPA
PLFPLGVPPASSPTPEPLAEALLQLQFDDGVGGSGPPPSTTTTTTTTQCALGGGIPDPGG
SPLDLGALLGDPPFDTIDAAELQRLLGPPETPPGGIGAGGGFGELLSLPTNFGDPPSSTA
ATFGPSPPMLLSYPEAITRLVQCQTPGGSGGGGPPVGPPQDLGGPLHPPGAPPQPTEDSL
PSLGDLDFSAFLSQFPSS
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgcggatctgctgcccctgtacctgcagccggaatggggcgagcaggagccg
gggggggccaccccttttgtggagatcctggagcagccgaagcagcgcgggatgcggttc
cgctataagtgtgaagggcgctcagctgggagcatccctggggagcacagcacagacagc
gcccgcacgcaccccaccatccgcgtaaaccattaccggggtccgggccgcgttcgggtc
tctttggtgacgaaggaccccccccacggcccccacccccacgagttggtgggccgccat
tgccagcatggctactatgaggccgagctcagccccgagcgctgcgtgcacagtttccag
aatttgggcattcagtgtgtgaagaaacgggaactggaagcggcggtggctgaacggatc
cgcaccaataacaaccccttcaatgtgccaatggaggagcgcggtgccgaatacgacctg
agcgcggtgcggctctgcttccaggtgtgggtgaacggccccggggggctctgcccgctg
ccccccgtcctctcccagcccatctatgacaaccgtgcccccagcacagccgagctgcgc
atcttgccgggtgaccgcaactctgggagctgccaggggggggatgagatcttcctgctc
tgtgacaaggtccagaaagaggacatcgaggttcgtttctgggctgagggctgggaggcg
aagggcagcttcgcggcggccgacgtacaccgccaggttgccatcgtgttccgcacgccg
cccttccgggagcgctccctccgccacccggtcaccgtccgcatggagctgcagcgcccc
tccgaccgccagcgcagcccccccctcgatttccgctacctgccccaccagggggacctg
cagtgcattgaggagaagcgcaaacgcacgcgggacaccttccgtgccttcgtccagcgg
gcaccactgccaggtctggaaccaaaccctgagccgcggcccccccggcgcattgcagtg
ccttcccggccccccccagccccccagcagccccccagcatggtgggagccccccctgct
ccccttttccctctgggggtgccccccgcctcctccccaaccccggagcctttggccgaa
gctctgctccaactgcagttcgacgatggggtgggggggtccggaccccccccctccacc
accaccaccaccaccacaacacaatgcgctctggggggcggcatccccgatccggggggg
tcccctttagatttgggggctcttctgggtgaccccccctttgataccatcgacgccgct
gagttgcaacgattgctgggcccccccgagacccccccaggtgggattggggctgggggg
ggttttggggagctcctctccctcccgacgaattttggggaccccccctcatccaccgcc
gccacatttgggccctccccccccatgctgctctcctatcccgaagccatcacacgtttg
gtgcagtgtcagaccccgggggggtcaggaggggggggacctcctgttggacccccccag
gatttaggggggcctctacatcctcccggagcccccccccagcccacggaggactccctg
ccctccctgggggacctggacttcagtgccttcctcagccagttcccttcatcctga

DBGET integrated database retrieval system