KEGG   Gallus gallus (chicken): 396027Help
Entry
396027            CDS       T01006                                 

Gene name
RELA
Definition
(RefSeq) v-rel avian reticuloendotheliosis viral oncogene homolog A
  KO
K04735  
transcription factor p65
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Apoptosis
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Adipocytokine signaling pathway
Insulin resistance
Salmonella infection
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    396027 (RELA)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    396027 (RELA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    396027 (RELA)
   04621 NOD-like receptor signaling pathway
    396027 (RELA)
   04622 RIG-I-like receptor signaling pathway
    396027 (RELA)
   04623 Cytosolic DNA-sensing pathway
    396027 (RELA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    396027 (RELA)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    396027 (RELA)
  Infectious diseases
   05132 Salmonella infection
    396027 (RELA)
   05164 Influenza A
    396027 (RELA)
   05168 Herpes simplex infection
    396027 (RELA)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    396027 (RELA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
Un
AA seq 558 aa AA seqDB search
MEPADLLPLYLQPEWGEQEPGGATPFVEILEQPKQRGMRFRYKCEGRSAGSIPGEHSTDS
ARTHPTIRVNHYRGPGRVRVSLVTKDPPHGPHPHELVGRHCQHGYYEAELSPERCVHSFQ
NLGIQCVKKRELEAAVAERIRTNNNPFNVPMEERGAEYDLSAVRLCFQVWVNGPGGLCPL
PPVLSQPIYDNRAPSTAELRILPGDRNSGSCQGGDEIFLLCDKVQKEDIEVRFWAEGWEA
KGSFAAADVHRQVAIVFRTPPFRERSLRHPVTVRMELQRPSDRQRSPPLDFRYLPHQGDL
QCIEEKRKRTRDTFRAFVQRAPLPGLEPNPEPRPPRRIAVPSRPPPAPQQPPSMVGAPPA
PLFPLGVPPASSPTPEPLAEALLQLQFDDGVGGSGPPPSTTTTTTTTQCALGGGIPDPGG
SPLDLGALLGDPPFDTIDAAELQRLLGPPETPPGGIGAGGGFGELLSLPTNFGDPPSSTA
ATFGPSPPMLLSYPEAITRLVQCQTPGGSGGGGPPVGPPQDLGGPLHPPGAPPQPTEDSL
PSLGDLDFSAFLSQFPSS
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgcggatctgctgcccctgtacctgcagccggaatggggcgagcaggagccg
gggggggccaccccttttgtggagatcctggagcagccgaagcagcgcgggatgcggttc
cgctataagtgtgaagggcgctcagctgggagcatccctggggagcacagcacagacagc
gcccgcacgcaccccaccatccgcgtaaaccattaccggggtccgggccgcgttcgggtc
tctttggtgacgaaggaccccccccacggcccccacccccacgagttggtgggccgccat
tgccagcatggctactatgaggccgagctcagccccgagcgctgcgtgcacagtttccag
aatttgggcattcagtgtgtgaagaaacgggaactggaagcggcggtggctgaacggatc
cgcaccaataacaaccccttcaatgtgccaatggaggagcgcggtgccgaatacgacctg
agcgcggtgcggctctgcttccaggtgtgggtgaacggccccggggggctctgcccgctg
ccccccgtcctctcccagcccatctatgacaaccgtgcccccagcacagccgagctgcgc
atcttgccgggtgaccgcaactctgggagctgccaggggggggatgagatcttcctgctc
tgtgacaaggtccagaaagaggacatcgaggttcgtttctgggctgagggctgggaggcg
aagggcagcttcgcggcggccgacgtacaccgccaggttgccatcgtgttccgcacgccg
cccttccgggagcgctccctccgccacccggtcaccgtccgcatggagctgcagcgcccc
tccgaccgccagcgcagcccccccctcgatttccgctacctgccccaccagggggacctg
cagtgcattgaggagaagcgcaaacgcacgcgggacaccttccgtgccttcgtccagcgg
gcaccactgccaggtctggaaccaaaccctgagccgcggcccccccggcgcattgcagtg
ccttcccggccccccccagccccccagcagccccccagcatggtgggagccccccctgct
ccccttttccctctgggggtgccccccgcctcctccccaaccccggagcctttggccgaa
gctctgctccaactgcagttcgacgatggggtgggggggtccggaccccccccctccacc
accaccaccaccaccacaacacaatgcgctctggggggcggcatccccgatccggggggg
tcccctttagatttgggggctcttctgggtgaccccccctttgataccatcgacgccgct
gagttgcaacgattgctgggcccccccgagacccccccaggtgggattggggctgggggg
ggttttggggagctcctctccctcccgacgaattttggggaccccccctcatccaccgcc
gccacatttgggccctccccccccatgctgctctcctatcccgaagccatcacacgtttg
gtgcagtgtcagaccccgggggggtcaggaggggggggacctcctgttggacccccccag
gatttaggggggcctctacatcctcccggagcccccccccagcccacggaggactccctg
ccctccctgggggacctggacttcagtgccttcctcagccagttcccttcatcctga

DBGET integrated database retrieval system