KEGG   Gallus gallus (chicken): 396029Help
Entry
396029            CDS       T01006                                 

Gene name
ZEB1, TCF8
Definition
(RefSeq) zinc finger E-box binding homeobox 1
  KO
K09299  
zinc finger homeobox protein 1/2
Organism
gga  Gallus gallus (chicken)
Brite
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, AbdB
    396029 (ZEB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
2
AA seq 1114 aa AA seqDB search
MADGPRCKRRKQANPRRNNVTNYNNVIEANSDSDDEDKLHIVEEESITDAADCDASVPED
DLPTDHTVLPENSEREGSTNSCWEDEGKETKEILGPEAQSDEVGCTVKEDECDSDAENEQ
NHDPNVEEFLQQEDTAVIYPEAPEEDQRQGTPEASGQDENGTPDAFSQLLTCPYCDRGYK
RFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLDRHMTSHKSGRDQRHVTQSSGNRKF
KCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLMPVKG
RARSGLKTSQCSSPSLSASPGSPARPQIRQKIENKPLQEQLPVNQIKTEPVDYEFKPIVV
ASGINCSTPLQNGVFSGGSPLQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVAV
DGNVIRQVLENNHANLASKEQETISNASIQQAGHSLISAISLPLVDQDGTTKIIINYSLE
QPSQLQVVPQNLKKEHSVPTNSCKNEKLPEDLTVKSEKDKNFEGETNDSTCLLCDDCPGD
LNALQELKHYETKNPPQLPQSSGTEAEKPSSPAPSETGENNLSPGQPPLKNLLSLLKAYY
ALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSGPSSPEQVKISSPTDNDD
QAATTNESEPQNSTNNSQNPANTSKSQTSSGGSTQNGSRSSTPSPSPLNLSSSRNSQGYT
YTAEGVQEEPQMEPLDLSLPKQHGELLERSTITSVYQNSVYSVQEEPLNLTCAKKEPQKD
NSITDSDPIVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQ
VAYTYSTTVSPAVQETPPKQTQANGSQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
NGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPY
QCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEVGQEVLSSEHAGARASPSQI
DSDERESLTREEEEDSEKEEEEEEEKDVEGLQEEKECRKLQDVEEEEEVEEEEEEEEGKT
EGNKNDDVVNRASNAEPEVIQSNGQVSEEKTNKA
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atggcggatggccccaggtgtaagcgcaggaagcaggcgaacccgaggcgcaacaacgtc
accaattacaataacgtgatagaagcaaactcagattcagatgacgaagataaattgcat
atagtggaagaagaaagtataactgatgcagcagactgcgatgcaagtgtgccagaagat
gacttgccaacagaccacaccgtgttaccagaaaacagtgagagggaagggagcacaaac
agctgctgggaagatgaaggaaaagaaacaaaggaaatcctggggcctgaagctcagtca
gatgaagttggatgtacagtaaaagaagatgaatgtgattctgatgcagaaaatgaacag
aaccatgaccctaatgttgaagaattccttcaacaagaagatacagctgttatttaccct
gaagcacctgaggaggaccagagacaaggcacaccagaagctagtggtcaggatgaaaat
ggaacgcccgatgcattttcccagctgctcacctgcccgtactgtgacagagggtacaaa
cgcttcacctctctgaaggaacacattaaataccgccatgaaaagaacgaggataacttc
agttgctccctctgcagttacacgtttgcgtatagaacacagctggaccgccacatgacg
tcgcacaagtcaggacgagatcagagacatgtgacgcagtccagtggtaatcgaaaattc
aagtgcactgaatgtggaaaagcttttaaatataaacatcatctaaaggaacacctacga
attcacagtggagagaagccatatgagtgcccaaactgcaagaaacgtttttcccattct
ggttcatacagctcacacataagcagtaagaagtgtattggtttgatgcccgtaaagggt
cgagctcggtcagggctcaagacgtctcagtgctcctccccttccctttctgcatcgccc
ggtagcccagcaagaccacagatacgacaaaagatagaaaataaacccttgcaagagcaa
cttcctgttaaccaaattaaaactgaacctgtggattatgaattcaagcccatagtggtt
gcttcaggaattaattgttcgacccctttgcagaatggggtttttagtggtggtagcccg
ttgcaggcaaccagttctcctcagggtgtggtgcaagctgttgttctgccaacagtgggt
ctggtgtctcccataagcatcaacttaagtgacattcaaaatgtacttaaagtggcagtg
gatggtaatgtaataaggcaagtattggaaaacaatcacgctaatcttgcatccaaagaa
caagaaacaatcagcaatgcatctatacaacaagctggccattccctcatttcagctatc
agtcttcctttggttgaccaagatgggacaaccaaaattatcatcaactacagcttggag
cagccaagtcaacttcaggttgttccccaaaatctaaaaaaagaacattctgttcctaca
aacagttgcaaaaatgaaaagttaccagaagatcttacggtgaagtctgagaaagataaa
aactttgaaggagagaccaacgatagcacttgtcttctttgtgatgactgtccaggagat
cttaatgcacttcaagaattaaagcactatgaaacaaaaaatcctcctcagcttccccag
tccagtggaacagaagctgagaagcccagctcccctgccccatcagaaactggggagaac
aacttatctcctggtcagccacccttaaagaaccttttatcgctcctaaaagcatattat
gcattaaatgcacaaccaagcgcagaagagctttcaaaaatcgccgattccgtgaaccta
ccactggatgtggtaaaaaagtggtttgaaaaaatgcaagctggacaaatttctgtgcag
tcttctggaccatcttctcctgaacaagttaaaataagcagtcccacagataacgatgat
caagcagcaactacaaatgagagtgaaccccagaacagcacaaacaactcacaaaatccg
gccaatacaagtaaatctcagacttcatcagggggatcaactcagaatggttcgcgcagt
agcacgccatccccatcaccactaaacctttcttcatcaagaaattcacagggttatacg
tacacagcagagggtgtacaagaagagccacaaatggaacctcttgacctttcactacca
aagcaacatggagaactgttggaaagatctaccataactagtgtttaccagaacagtgtt
tattctgtccaggaagaacctttgaacttaacttgtgcaaaaaaagaaccacaaaaggac
aacagtattacagactctgatcctattgtaaatgtaatcccaccaagtgccaatcccata
aatattgctatacctacagtcactgcccagttacctacaattgttgccattgctgaccag
aacagtgttccatgcttgagagctcttgctgccaataagcaaaccattttgattccccag
gtggcttatacgtactctactacagttagtcctgcagttcaggaaacaccaccaaaacag
acccaagccaacggaagtcaggacgaaaggcaggacactagctcagaaggagtatcgaat
gtagaagatcaaaatgattctgattcaacacccccaaagaaaaagatgagaaagacagaa
aatgggatgtatgcatgtgatttgtgtgacaaaatattccagaagagcagctcattattg
agacataagtatgaacacacaggtaaaagacctcatgagtgtggaatctgtaaaaaagcc
ttcaaacacaaacaccatttgatcgaacacatgcgactgcattctggggagaaaccctac
caatgtgacaaatgcgggaagcgcttctcacactcggggtcgtactctcagcacatgaat
catcgctactcctattgcaaaagagaggcagaggagcgtgacagcacagagcaggaggag
gtgggacaggaggtgctcagcagcgagcatgctggtgccagagcatcgccatcgcagatc
gactccgatgagagagagagtctaaccagggaagaagaggaagatagtgaaaaagaggaa
gaggaggaggaagaaaaggacgtagaaggacttcaggaagaaaaagaatgtagaaaacta
caagatgtagaggaggaagaagaagtagaagaagaagaagaagaagaggaagggaaaact
gaaggtaacaagaacgatgacgttgtaaatcgagcaagcaatgcagaaccagaagttata
cagagcaatgggcaggtgtcagaagaaaaaacaaataaagcttaa

DBGET integrated database retrieval system