KEGG   Gallus gallus (chicken): 396033Help
Entry
396033            CDS       T01006                                 

Gene name
NFKB1, NF-KB1
Definition
(RefSeq) nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
  KO
K02580  
nuclear factor NF-kappa-B p105 subunit
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Adipocytokine signaling pathway
Insulin resistance
AGE-RAGE signaling pathway in diabetic complications
Salmonella infection
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    396033 (NFKB1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    396033 (NFKB1)
   04621 NOD-like receptor signaling pathway
    396033 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    396033 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    396033 (NFKB1)
  Endocrine system
   04920 Adipocytokine signaling pathway
    396033 (NFKB1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    396033 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    396033 (NFKB1)
  Infectious diseases
   05132 Salmonella infection
    396033 (NFKB1)
   05164 Influenza A
    396033 (NFKB1)
   05168 Herpes simplex infection
    396033 (NFKB1)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    396033 (NFKB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 983 aa AA seqDB search
MAGEDPYIMGVSDPQMFAMDQLMGMSTIFNNTGYITSDLPLRTADGPYLQIIEQPKQRGF
RFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKYVHLHAHSLVG
KFCEDGVCTVNAGPKDMVVGFANLGILHVTKKKVFETLETRMIDACKKGYNPGLLVHPEL
GYLQAEGCGDRQLTEREREIIRQAAVQQTKEMDLSVVRLMFTAFLPDSNGGFTRRLDPVI
SDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEDENGGMWE
GFGDFSPTDVHRQFAIVFKTPKYRDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKD
KEEVQRKRQKLMPNFSDGYGGGSGAGGGGMFGGGGGGAGSGFSYPSYGYSAFGGMHFHPG
TTKSNAGMKHELSNSTVKKDEESSDKQSDKWDTKHDVKVETVEKNECRTSGHNEEKEDAS
LCCKDEGNKPKCGCQDGLFLEKAMQLAKRHCNALFDYAVTGDVRMLLAVQRHLTAVQDDN
GDNVLHLSIIHLHRELVKNLLEVMPDMNYNNIINMRNDLYQTPLHLAVITKQAEVVEDLL
KAGANVNLLDRHGNSVLHLAAAEGDDKILSLLLKHQKASSMIDLSNGEGLSAIHMVVTAN
SLSCLKLLIAAGVDVNAQEQKSGRTALHLAVEQENIPLAGCLLLEGDVDADSTTYDGTTP
LHIAAGRGFTKLAAVLKAAGADPHVENFEPLFDVEEDVKDDDDDEGIVPGTTPLDMAANW
EVYDILNGKPYIAAAAVSEDLLSQGPLRELNESSKQQLYKLLETPDPSKNWSTLAEKLGL
GILNNAFRLSPSPSKTLLDNYKISGGTVQELIAALTQMDHTEAIEVIQKALSSSQRQIYQ
EDNTIEAFPSLSPTSFAKEETGELYNHKFQDPESTCDSGVETSFRKLSFTYSDSLNSKSS
ITLSKMTLGYGQESSVQSSYIPN
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagaggatccgtatattatgggagtgtcagatccccaaatgtttgcaatggac
cagctcatgggaatgagtacaatatttaataatacaggttacatcacttcagacttacca
ctacgaacagcagatggaccgtatcttcaaatcattgaacagccaaaacagaggggtttt
cgattccgatacgtatgcgaagggccttcacatggtggacttcctggtgcttctagtgaa
aagaacaaaaagtcatacccccaagtcaaaatttgcaactatgttggacctgcaaaagta
atcgtccagttagttactaatgggaaatacgtccacttacatgctcacagcttggtgggt
aaattttgtgaagacggagtatgcacagtcaacgcaggacctaaagacatggttgttggg
tttgcaaaccttggaatacttcacgtcacaaagaagaaagtgtttgaaactctggaaaca
cgcatgatcgatgcttgcaaaaaaggatacaacccaggactcttggtgcatcctgaactt
ggctatctgcaggctgaaggatgtggagacagacagctaactgaacgagaaagagaaatt
attcgccaggcagcagtacagcagacaaaagaaatggatctcagtgtggtgcgtcttatg
tttactgcctttcttcctgacagtaacggtggtttcacacggaggcttgatcctgttata
tcggatgcaatatatgacagcaaagcgcccaatgcctccaacttaaaaattgtaagaatg
gacaggacagcggggtgcgtaacaggaggggaagagatttaccttctctgtgacaaggtt
cagaaagatgatattcaaatacgtttctatgaagaggatgagaatggtggtatgtgggaa
ggctttggagacttttctcctacagatgtacatagacaatttgctattgtgttcaaaacg
cccaagtatcgagatgtcaacatcacaaagccagcatctgtatttgtacaactacgtcgg
aaatctgatctagaaacgagtgaaccaaagccttttctctactacccagaaatcaaagat
aaagaagaagtgcagaggaagaggcagaagctcatgccaaacttctccgatggctacggt
ggaggcagcggcgcaggcggcggtggcatgtttggaggaggaggcggcggtgctggctct
gggttcagttatccttcctatggctactctgcttttggaggaatgcatttccaccctggc
acaacgaagtccaatgctggaatgaaacacgaactgtcaaatagcacagtcaaaaaagat
gaagagagctctgataaacaaagtgacaaatgggacacaaaacatgacgtgaaagtggaa
actgtggagaagaatgagtgcagaacctctggtcataatgaggagaaagaggatgcttcg
ttgtgctgtaaagatgaaggaaacaaaccaaagtgtggttgtcaggatggtctgttcctg
gagaaggctatgcagcttgccaagcgtcactgcaacgctctctttgattatgctgtaact
ggagatgtgaggatgctgctagctgttcagcgccatctcactgctgtccaggatgacaat
ggagacaatgtccttcatttgtcaattatccaccttcatagagaactggttaaaaacctc
ttggaagtgatgccagatatgaattataacaacattatcaacatgagaaatgacctttac
cagaccccgctgcacctggcagtaatcacaaagcaggcagaggtggtagaagacctgctg
aaggctggagcaaatgtcaaccttttggatcgccatggtaattctgtcttgcacttagct
gctgctgaaggagatgacaagattctgagtctgctcctcaagcatcagaaggcatcttca
atgatcgacctttccaatggtgaaggtctcagtgcaattcacatggtggtgaccgccaat
agcttgtcctgtctgaaactactgattgctgctggagttgatgtcaatgctcaggaacaa
aaatctggacgaacggcattgcatttagctgttgaacaagagaacatccccttggcaggc
tgccttttgcttgagggtgatgtagacgcggacagcactacatacgatggcacaacgcct
cttcacatagcagctggaaggggcttcacaaaactggcagcagttctcaaagcagcaggc
gcagatcctcacgttgagaactttgagccgctctttgatgtagaagaagatgtgaaagat
gatgatgatgatgaaggaatcgtaccgggaacaacaccactggatatggcagccaactgg
gaggtgtatgacatattaaatggcaaaccctacatagcagcagcggcagtttcagaggat
ttactgtcacaaggccctctgagagagctgaatgaaagctccaagcagcagctttacaag
ctattggaaacgcctgatccaagcaagaactggtctactctagcagaaaagctgggtctt
ggcattcttaataatgccttcaggttgagcccttcaccctcaaaaactctgctggataac
tataagatttctggaggtacagttcaagagctgatcgctgctttgacacagatggatcac
acagaagctattgaagtaattcagaaagcactatctagctcacaaaggcagatataccag
gaggacaacacaatagaagcttttccttcattatcaccaaccagttttgcaaaggaagag
acaggtgaactttacaatcacaaatttcaagaccctgaaagcacgtgtgacagcggcgta
gagacctccttccgcaaactgagctttacttattcagactctctgaacagcaagtcatcc
ataacgcttagcaagatgaccctgggctacggccaggaaagctcagtgcaaagcagttat
atacctaactag

DBGET integrated database retrieval system