KEGG   Gallus gallus (chicken): 396033Help
Entry
396033            CDS       T01006                                 

Gene name
NFKB1, NF-KB1
Definition
(RefSeq) nuclear factor kappa B subunit 1
  KO
K02580  
nuclear factor NF-kappa-B p105 subunit
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Apoptosis
Cellular senescence
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Adipocytokine signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Salmonella infection
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    396033 (NFKB1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    396033 (NFKB1)
   04218 Cellular senescence
    396033 (NFKB1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    396033 (NFKB1)
   04621 NOD-like receptor signaling pathway
    396033 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    396033 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    396033 (NFKB1)
  Endocrine system
   04920 Adipocytokine signaling pathway
    396033 (NFKB1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    396033 (NFKB1)
  Infectious diseases
   05132 Salmonella infection
    396033 (NFKB1)
   05164 Influenza A
    396033 (NFKB1)
   05168 Herpes simplex infection
    396033 (NFKB1)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    396033 (NFKB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 983 aa AA seqDB search
MAGEDPYIMGVSDPQMFAMDQLMGMSTIFNNTGYITSDLPLRTADGPYLQIIEQPKQRGF
RFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKYVHLHAHSLVG
KFCEDGVCTVNAGPKDMVVGFANLGILHVTKKKVFETLETRMIDACKKGYNPGLLVHPEL
GYLQAEGCGDRQLTEREREIIRQAAVQQTKEMDLSVVRLMFTAFLPDSNGGFTRRLDPVI
SDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEDENGGMWE
GFGDFSPTDVHRQFAIVFKTPKYRDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKD
KEEVQRKRQKLMPNFSDGYGGGSGAGGGGMFGGGGGGAGSGFSYPSYGYSAFGGMHFHPG
TTKSNAGMKHELSNSTVKKDEESSDKQSDKWDTKHDVKVETVEKNECRTSGHNEEKEDAS
LCCKDEGNKPKCGCQDGLFLEKAMQLAKRHCNALFDYAVTGDVRMLLAVQRHLTAVQDDN
GDNVLHLSIIHLHRELVKNLLEVMPDMNYNNIINMRNDLYQTPLHLAVITKQAEVVEDLL
KAGANVNLLDRHGNSVLHLAAAEGDDKILSLLLKHQKASSMIDLSNGEGLSAIHMVVTAN
SLSCLKLLIAAGVDVNAQEQKSGRTALHLAVEQENIPLAGCLLLEGDVDADSTTYDGTTP
LHIAAGRGFTKLAAVLKAAGADPHVENFEPLFDVEEDVKDDDDDEGIVPGTTPLDMAANW
EVYDILNGKPYIAAAAVSEDLLSQGPLRELNESSKQQLYKLLETPDPSKNWSTLAEKLGL
GILNNAFRLSPSPSKTLLDNYKISGGTVQELIAALTQMDHTEAIEVIQKALSSSQRQIYQ
EDNTIEAFPSLSPTSFAKEETGELYNHKFQDPESTCDSGVETSFRKLSFTYSDSLNSKSS
ITLSKMTLGYGQESSVQSSYIPN
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagaggatccgtatattatgggagtgtcagatccccaaatgtttgcaatggac
cagctcatgggaatgagtacaatatttaataatacaggttacatcacttcagacttacca
ctacgaacagcagatggaccgtatcttcaaatcattgaacagccaaaacagaggggtttt
cgattccgatacgtatgcgaagggccttcacatggtggacttcctggtgcttctagtgaa
aagaacaaaaagtcatacccccaagtcaaaatttgcaactatgttggacctgcaaaagta
atcgtccagttagttactaatgggaaatacgtccacttacatgctcacagcttggtgggt
aaattttgtgaagacggagtatgcacagtcaacgcaggacctaaagacatggttgttggg
tttgcaaaccttggaatacttcacgtcacaaagaagaaagtgtttgaaactctggaaaca
cgcatgatcgatgcttgcaaaaaaggatacaacccaggactcttggtgcatcctgaactt
ggctatctgcaggctgaaggatgtggagacagacagctaactgaacgagaaagagaaatt
attcgccaggcagcagtacagcagacaaaagaaatggatctcagtgtggtgcgtcttatg
tttactgcctttcttcctgacagtaacggtggtttcacacggaggcttgatcctgttata
tcggatgcaatatatgacagcaaagcgcccaatgcctccaacttaaaaattgtaagaatg
gacaggacagcggggtgcgtaacaggaggggaagagatttaccttctctgtgacaaggtt
cagaaagatgatattcaaatacgtttctatgaagaggatgagaatggtggtatgtgggaa
ggctttggagacttttctcctacagatgtacatagacaatttgctattgtgttcaaaacg
cccaagtatcgagatgtcaacatcacaaagccagcatctgtatttgtacaactacgtcgg
aaatctgatctagaaacgagtgaaccaaagccttttctctactacccagaaatcaaagat
aaagaagaagtgcagaggaagaggcagaagctcatgccaaacttctccgatggctacggt
ggaggcagcggcgcaggcggcggtggcatgtttggaggaggaggcggcggtgctggctct
gggttcagttatccttcctatggctactctgcttttggaggaatgcatttccaccctggc
acaacgaagtccaatgctggaatgaaacacgaactgtcaaatagcacagtcaaaaaagat
gaagagagctctgataaacaaagtgacaaatgggacacaaaacatgacgtgaaagtggaa
actgtggagaagaatgagtgcagaacctctggtcataatgaggagaaagaggatgcttcg
ttgtgctgtaaagatgaaggaaacaaaccaaagtgtggttgtcaggatggtctgttcctg
gagaaggctatgcagcttgccaagcgtcactgcaacgctctctttgattatgctgtaact
ggagatgtgaggatgctgctagctgttcagcgccatctcactgctgtccaggatgacaat
ggagacaatgtccttcatttgtcaattatccaccttcatagagaactggttaaaaacctc
ttggaagtgatgccagatatgaattataacaacattatcaacatgagaaatgacctttac
cagaccccgctgcacctggcagtaatcacaaagcaggcagaggtggtagaagacctgctg
aaggctggagcaaatgtcaaccttttggatcgccatggtaattctgtcttgcacttagct
gctgctgaaggagatgacaagattctgagtctgctcctcaagcatcagaaggcatcttca
atgatcgacctttccaatggtgaaggtctcagtgcaattcacatggtggtgaccgccaat
agcttgtcctgtctgaaactactgattgctgctggagttgatgtcaatgctcaggaacaa
aaatctggacgaacggcattgcatttagctgttgaacaagagaacatccccttggcaggc
tgccttttgcttgagggtgatgtagacgcggacagcactacatacgatggcacaacgcct
cttcacatagcagctggaaggggcttcacaaaactggcagcagttctcaaagcagcaggc
gcagatcctcacgttgagaactttgagccgctctttgatgtagaagaagatgtgaaagat
gatgatgatgatgaaggaatcgtaccgggaacaacaccactggatatggcagccaactgg
gaggtgtatgacatattaaatggcaaaccctacatagcagcagcggcagtttcagaggat
ttactgtcacaaggccctctgagagagctgaatgaaagctccaagcagcagctttacaag
ctattggaaacgcctgatccaagcaagaactggtctactctagcagaaaagctgggtctt
ggcattcttaataatgccttcaggttgagcccttcaccctcaaaaactctgctggataac
tataagatttctggaggtacagttcaagagctgatcgctgctttgacacagatggatcac
acagaagctattgaagtaattcagaaagcactatctagctcacaaaggcagatataccag
gaggacaacacaatagaagcttttccttcattatcaccaaccagttttgcaaaggaagag
acaggtgaactttacaatcacaaatttcaagaccctgaaagcacgtgtgacagcggcgta
gagacctccttccgcaaactgagctttacttattcagactctctgaacagcaagtcatcc
ataacgcttagcaagatgaccctgggctacggccaggaaagctcagtgcaaagcagttat
atacctaactag

DBGET integrated database retrieval system