KEGG   Gallus gallus (chicken): 396043Help
Entry
396043            CDS       T01006                                 

Gene name
JAG1
Definition
(RefSeq) jagged 1
  KO
K06052  
jagged-1
Organism
gga  Gallus gallus (chicken)
Pathway
Notch signaling pathway
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    396043 (JAG1)
   04371 Apelin signaling pathway
    396043 (JAG1)
CD molecules [BR:gga04090]
 Proteins
  396043 (JAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
3
AA seq 1216 aa AA seqDB search
MRAARRAAARSLVLFLALLGLRAQVASASGQFELEILSVQNVNGVLQNGNCCDGTRNPGD
KKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSKSTPVIGGNTFNLKYSRNNEKNRIVIP
FSFAWPRSYTLLVEAWDYNDNSTNPDRIIEKASHSGMINPSRQWQTLKHNTGAAHFEYQI
RVTCAEHYYGFGCNKFCRPRDDFFTHHTCDQNGNKTCLEGWTGPECNKAICRQGCSPKHG
SCTVPGECRCQYGWQGQYCDKCIPHPGCVHGTCIEPWQCLCETNWGGQLCDKDLNYCGTH
PPCLNGGTCSNTGPDKYQCSCPEGYSGQNCEIAEHACLSDPCHNGGSCLETSTGFECVCA
PGWAGPTCTDNIDDCSPNPCGHGGTCQDLVDGFKCICPPQWTGKTCQLDANECEGKPCVN
ANSCRNLIGSYYCDCITGWSGHNCDININDCRGQCQNGGSCRDLVNGYRCICSPGYAGDH
CEKDINECASNPCMNGGHCQDEINGFQCLCPAGFSGNLCQLDIDYCEPNPCQNGAQCFNL
AMDYFCNCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHG
KCKSQAGGKFTCECNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWEGTY
CETNINDCSKNPCHNGGTCRDLVNDFFCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDE
GDTFKCMCPAGWEGATCNIARNSSCLPNPCHNGGTCVVSGDSFTCVCKEGWEGPTCTQNT
NDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYR
CICPPGRSGPGCQEVTGRPCFTSIRVMPDGAKWDDDCNTCQCLNGKVTCSKVWCGPRPCI
IHAKGHNECPAGHACVPVKEDHCFTHPCAAVGECWPSNQQPVKTKCNSDSYYQDNCANIT
FTFNKEMMAPGLTTEHICSELRNLNILKNVSAEYSIYITCEPSHLANNEIHVAISAEDIG
EDENPIKEITDKIIDLVSKRDGNNTLIAAVAEVRVQRRPVKNKTDFLVPLLSSVLTVAWI
CCLVTVFYWCIQKRRKQSSHTHTASDDNTTNNVREQLNQIKNPIEKHGANTVPIKDYENK
NSKIAKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDRDEKPPNSTPTKHPNWTNKQDN
RDLESAQSLNRMEYIV
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcggcccggcgggcggcggcgcgctccctcgtcctcttcctggccctgctgggg
ctgcgggctcaggtggcgtcagcatcgggacagttcgagctggagatcttatccgtgcag
aatgtgaacggcgtgctgcagaacgggaactgctgcgacggcactcgaaaccccggagat
aaaaagtgcaccagagatgagtgtgacacctactttaaagtttgcctgaaggagtaccag
tcgcgggtcactgctggcggcccttgcagcttcggatccaaatccacccctgtcatcggc
gggaataccttcaatttaaagtacagccggaataatgaaaagaaccggattgttatccct
ttcagcttcgcctggccgagatcctacacgttgcttgttgaggcatgggattacaatgat
aactctactaatcccgatcgcataattgagaaggcatcccactctggcatgatcaatcca
agccgtcagtggcagacgttgaaacataacacaggagctgcccactttgagtatcaaatc
cgtgtgacttgcgcagaacattactatggctttggatgcaacaagttttgtcgaccgaga
gatgacttcttcactcaccatacctgtgaccagaatggcaacaaaacctgcttggaaggc
tggacgggaccagaatgcaacaaagctatttgtcgtcagggatgtagccccaagcatggt
tcttgcacagttccaggagagtgcaggtgtcaatatggatggcaaggccagtactgtgat
aagtgcattccacacccaggatgtgtccatggcacttgcattgaaccatggcagtgcctc
tgtgaaaccaactggggtggtcagctctgtgacaaagacctgaactactgtggaacccac
ccaccctgtttgaatggtggtacctgcagcaacactggccccgataaataccagtgttcc
tgccctgagggttactcaggacagaactgtgaaatagcggagcacgcgtgcctctctgat
ccgtgccacaacggaggaagctgcctagaaacgtctacaggatttgaatgtgtgtgtgca
cctggctgggctggaccaacttgcactgataatattgatgattgttctccaaatccctgt
ggtcatggaggaacttgccaagatctagttgatggatttaagtgtatttgcccacctcag
tggactggcaaaacatgccagctagatgcgaatgaatgtgagggcaaaccctgtgtcaat
gccaactcctgcaggaacctgattggcagctactattgtgactgcattactggctggtct
ggccacaactgtgatataaatatcaatgattgtcgtggacaatgtcagaatggaggatcc
tgtcgggacttggttaatggttatcggtgcatctgttcacctggctatgcaggagatcac
tgtgagaaagacatcaatgaatgtgcaagtaacccttgcatgaatgggggtcactgccag
gatgaaatcaatggattccaatgtctgtgtcctgctggtttctcaggaaacctctgtcag
ctggatatagactactgtgagccaaacccttgccagaacggtgcccagtgcttcaatctt
gctatggactatttctgtaactgccctgaagattacgaaggcaagaactgctcccacctg
aaagatcactgccgcacaactccttgtgaagtaatcgacagctgtacagtggcagtggct
tctaacagcacaccagaaggagttcgttacatttcttcaaatgtctgtggtcctcatgga
aaatgcaagagccaagcaggtggaaaattcacctgtgaatgcaacaaaggattcactggc
acctactgtcatgagaatatcaatgactgtgagagcaacccctgtaaaaatggtggcact
tgtattgacggtgtaaactcctacaaatgtatttgtagtgatggatgggaaggaacatat
tgtgaaacaaatattaatgactgcagtaaaaacccctgccacaatggaggaacttgccga
gacttggtcaatgacttcttctgtgaatgtaaaaatgggtggaaaggaaaaacttgccac
tctcgtgacagccagtgtgatgaggcaacatgcaataatggaggaacatgttatgatgag
ggggacactttcaagtgcatgtgtcctgcaggatgggaaggagccacttgtaatatagca
aggaacagcagctgcctgccaaacccctgtcacaatggtggtacctgtgtagttagtggg
gattctttcacttgtgtctgcaaggagggctgggaaggaccgacatgcactcagaacaca
aatgactgcagtcctcatccttgttacaacagtggtacttgtgtggatggagacaactgg
taccgctgtgagtgcgctcccggcttcgcaggtcccgactgtaggatcaacatcaatgaa
tgtcagtcttcaccctgtgcctttggggctacttgcgtggatgaaattaatgggtaccgt
tgcatttgtccaccgggtcgcagtggtccaggatgccaggaagttacagggaggccttgc
tttaccagtattcgagtaatgccagacggtgctaagtgggatgatgactgtaatacttgt
cagtgtttgaatggaaaagtcacctgttctaaggtttggtgtggtcctcgaccttgtata
atacatgccaaaggtcataatgaatgcccagctggacatgcttgtgttcctgttaaagaa
gaccattgtttcactcatccttgtgctgcagtgggtgaatgctggccttctaatcaacaa
cctgtgaagaccaaatgcaattctgattcttattaccaagataattgtgccaacatcacc
ttcacctttaataaggaaatgatggcaccaggccttaccacggagcacatttgcagtgaa
ttgaggaatctgaatatcctgaagaatgtttctgctgaatattccatctatattacctgt
gagccttcacacttggcaaataatgaaatacatgttgctatttctgctgaagatatagga
gaagatgaaaacccaatcaaggaaatcacagataagattattgaccttgtcagtaagcgt
gatggaaacaacacactaattgctgcagtcgcagaagtcagagtacaaaggcgaccagtt
aagaacaaaacagatttcttggtgccattactgagctcagtcttaacagtagcctggatc
tgctgtctggtaactgttttctattggtgcattcaaaagcgcagaaagcagagcagccat
actcacacagcatctgatgacaacaccaccaacaacgtaagggagcagctgaatcagatt
aaaaaccccatagagaaacacggagcaaatactgttccaattaaagactatgaaaacaaa
aactctaaaatcgccaaaataaggacgcacaattcagaagtggaggaagatgacatggac
aaacaccagcaaaaggcccggtttgccaagcagccagcgtacactttggtagacagagat
gaaaagccacccaacagcacacccacaaaacacccaaactggacaaataaacaggacaac
agagacttggaaagtgcacaaagtttaaatagaatggagtacattgtatag

DBGET integrated database retrieval system