KEGG   Gallus gallus (chicken): 396051Help
Entry
396051            CDS       T01006                                 

Gene name
CYP1A1, CYP1A5
Definition
cytochrome P450, family 1, subfamily A, polypeptide 1 (EC:1.14.14.1)
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:gga00140]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:gga00380]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:gga00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:gga00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
10
AA seq 528 aa AA seqDB search
MGPEEVMVQASSPGLISATEVLVAAATFCLLLLLTQTRRQHAPKGLRSPPGPRGLPMLGS
VLELRKDPHLVLTRLSRKYGDVMEVTIGSRPVVVLSGLETIKQALVRQAEDFMGRPDLYS
FRHITDGQSLTFSTDTGEMWKARRKLAQNALKNFSIAASPTASSSCLLEEHVSTEASYLV
TKFLQLMEEKQSFDPYRYMVVSVANVICAICFGKRYDHDDQELLSVVNVVDEFVDVTAAG
NPADFIPLLRYLPSRNMDSFLDFNKRFMKLLQTAVEEHYQTFDKNNIRDVTDSLIEQCVE
KKAEANGATQIPNEKIINLVNDIFGAGFDTVTTALSWSLMYLVTYPHMQKKIQAELDQTI
GRERRPRLSDRGMLPYTEAFILEMFRHSSFMPFTIPHSTTRDTVLNGYYIPKDRCVFINQ
WQVNHDEKLWKDPQAFNPERFLNAEGTEVNKVDAEKVMTFGLGKRRCIGENIGKWEVFLF
LSTLLQQLEFSIQDGKKADMTPIYGLSMKHKRCEHFQVKKRFSMKSSN
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggggccggaggaagtgatggtgcaggcgagcagcccaggtctcatctcggccaccgag
gtgctggtggcagctgccactttctgcctgctcctgctgctgacccagacccgccggcag
cacgcacccaaggggctgcgcagccctccgggtccccgcgggctccccatgctgggcagt
gtgctggagctgaggaaggacccacacctggtgctcacccggctgagccgcaaatacggg
gacgtgatggaggtgaccatcggctcccggcccgtggtggtgctcagcgggctggaaacc
atcaagcaagccttggtgaggcaagcggaagacttcatgggacgccccgacctctacagc
ttccgacacattacggatgggcagagtttgaccttcagcaccgacacgggggaaatgtgg
aaagcccgcaggaagctggcgcagaacgccctgaagaacttctccatcgccgccagcccc
acggcctcctccagctgcctcctggaggagcacgtctccaccgaggccagctacctggtc
accaaattcctgcagctgatggaggagaagcagagcttcgacccctaccgctacatggtg
gtgtcggtggccaacgtcatctgcgccatatgcttcggcaagcgctacgaccacgacgac
caggagctgctcagcgtggtgaacgtggtcgatgagtttgtggatgtgactgctgctggc
aacccggctgacttcatccctctgctccgctacctccccagccgcaacatggattcgttt
ctggatttcaacaagcgattcatgaagttgttgcagacagctgtggaagagcactaccag
accttcgacaagaacaacatccgagacgtcaccgactccctcatcgagcagtgcgtggag
aaaaaagccgaagccaacggtgccacgcagatcccaaacgagaagatcatcaacctggtg
aatgacatctttggagcaggctttgacaccgtgacaaccgccctgtcctggagcctcatg
tacctcgtgacgtaccctcacatgcagaagaagattcaggcagagctggatcagaccatc
ggccgggagaggagaccacggctgtccgaccgaggtatgctgccctacacagaagccttc
atcctggagatgttccggcactcctccttcatgcccttcaccatcccgcacagcacgacc
agggacacggtgctgaatggctactatatcccaaaggaccgttgcgtgtttatcaaccag
tggcaagtgaatcacgatgagaaactttggaaggacccacaggctttcaacccagagcgt
ttcctcaacgctgaagggaccgaagtgaacaaagtggatgcggagaaggtgatgactttt
ggcctggggaaaaggaggtgcattggggaaaacataggcaagtgggaggtgttccttttc
ctgtccacgttgctccagcaactggagttcagcatccaggatggcaagaaggcagacatg
acgcctatctatggactgtccatgaagcacaagagatgtgagcactttcaagtcaagaaa
cgcttctccatgaagagctcaaactaa

DBGET integrated database retrieval system