KEGG   Gallus gallus (chicken): 396054Help
Entry
396054            CDS       T01006                                 

Gene name
IFNG
Definition
interferon, gamma
Orthology
K04687  
interferon gamma
Organism
gga  Gallus gallus (chicken)
Pathway
Proteasome
Cytokine-cytokine receptor interaction
Regulation of autophagy
TGF-beta signaling pathway
Jak-STAT signaling pathway
Salmonella infection
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    396054 (IFNG)
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    396054 (IFNG)
   04630 Jak-STAT signaling pathway
    396054 (IFNG)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    396054 (IFNG)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    396054 (IFNG)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    396054 (IFNG)
   05164 Influenza A
    396054 (IFNG)
   05168 Herpes simplex infection
    396054 (IFNG)
Heparan sulfate/heparin binding proteins [BR:gga00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  396054 (IFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1; 1:1 248.1 cM
AA seq 164 aa AA seqDB search
MTCQTYNLFVLSVIMIYYGHTASSLNLVQLQDDIDKLKADFNSSHSDVADGGPIIVEKLK
NWTERNEKRIILSQIVSMYLEMLENTDKSKPHIKHISEELYTLKNNLPDGVKKVKDIMDL
AKLPMNDLRIQRKAANELFSILQKLVDPPSFKRKRSQSQRRCNC
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacttgccagacttacaacttgtttgttctgtctgtcatcatgatttattatggacat
actgcaagtagtctaaatcttgttcaacttcaagatgatatagacaaactgaaagctgac
tttaactcaagtcattcagatgtagctgacggtggacctattattgtagagaaactgaag
aactggacagagagaaatgagaaaaggatcatactgagccagattgtttcgatgtacttg
gaaatgcttgaaaacactgacaagtcaaagccgcacatcaaacacatatctgaggagctc
tatactctgaaaaacaaccttcctgatggcgtgaagaaggtgaaagatatcatggacctg
gccaagctcccgatgaacgacttgagaatccagcgcaaagccgcgaatgaactcttcagc
atcttacagaagctggtggatcctccgagtttcaaaaggaaaaggagccagtctcagagg
agatgcaattgctaa

DBGET integrated database retrieval system