KEGG   Gallus gallus (chicken): 396054Help
Entry
396054            CDS       T01006                                 

Gene name
IFNG
Definition
interferon, gamma
Orthology
K04687  
interferon gamma
Organism
gga  Gallus gallus (chicken)
Pathway
Proteasome
Cytokine-cytokine receptor interaction
Regulation of autophagy
TGF-beta signaling pathway
Jak-STAT signaling pathway
Salmonella infection
Influenza A
Herpes simplex infection
Class
Genetic Information Processing; Folding, sorting and degradation; Proteasome [PATH:gga03050]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:gga04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:gga04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:gga04060]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:gga04140]
Human Diseases; Infectious diseases; Salmonella infection [PATH:gga05132]
Human Diseases; Infectious diseases; Influenza A [PATH:gga05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:gga05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1; 1:1 248.1 cM
AA seq 164 aa AA seqDB search
MTCQTYNLFVLSVIMIYYGHTASSLNLVQLQDDIDKLKADFNSSHSDVADGGPIIVEKLK
NWTERNEKRIILSQIVSMYLEMLENTDKSKPHIKHISEELYTLKNNLPDGVKKVKDIMDL
AKLPMNDLRIQRKAANELFSILQKLVDPPSFKRKRSQSQRRCNC
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacttgccagacttacaacttgtttgttctgtctgtcatcatgatttattatggacat
actgcaagtagtctaaatcttgttcaacttcaagatgatatagacaaactgaaagctgac
tttaactcaagtcattcagatgtagctgacggtggacctattattgtagagaaactgaag
aactggacagagagaaatgagaaaaggatcatactgagccagattgtttcgatgtacttg
gaaatgcttgaaaacactgacaagtcaaagccgcacatcaaacacatatctgaggagctc
tatactctgaaaaacaaccttcctgatggcgtgaagaaggtgaaagatatcatggacctg
gccaagctcccgatgaacgacttgagaatccagcgcaaagccgcgaatgaactcttcagc
atcttacagaagctggtggatcctccgagtttcaaaaggaaaaggagccagtctcagagg
agatgcaattgctaa

DBGET integrated database retrieval system