KEGG   Gallus gallus (chicken): 396099Help
Entry
396099            CDS       T01006                                 

Gene name
ESR1
Definition
(RefSeq) estrogen receptor 1
  KO
K08550  
estrogen receptor alpha
Organism
gga  Gallus gallus (chicken)
Brite
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    396099 (ESR1)
Nuclear receptors [BR:gga03310]
 3. Estrogen like
  3A. Estrogen receptor
   396099 (ESR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 589 aa AA seqDB search
MTMTLHTKASGVTLLHQIQGTELETLSRPQLKIPLERSLSDMYVESNKTGVFNYPEGATY
DFGTTAPVYGSTTLSYAPTSESFGSSSLAGFHSLNNVPPSPVVFLQTAPQLSPFIHHHSQ
QVPYYLENEQGSFGMREAAPPAFYRPSSDNRRHSIRERMSSTNEKGSLSMESTKETRYCA
VCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCY
EVGMMKGGIRKDRRGGEMMKQKRQREEQDSRNGEASSTELRAPTLWTSPLVVKHNKKNSP
ALSLTAEQMVSALLEAEPPIVYSEYDPNRPFNEASMMTLLTNLADRELVHMINWAKRVPG
FVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFD
MLLATAARFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEERDYIHRVLDKITDTL
IHLMAKSGLSLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDA
HRLHAPAARSAAPMEEENRNQLTTAPASSHSLQSFYINSKEEESMQNTI
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacccttcacaccaaagcctctggagttaccctgctgcaccagattcaaggc
actgagctggagactctgagcagacctcagctgaagattcccctggaacgatcgctcagc
gacatgtacgtggaaagcaacaagacaggagtttttaactacccagaaggggccacctac
gattttggtactaccgctccagtgtacggctctactacactcagttatgcccctacttct
gaatcttttgggtcaagcagcctggcaggatttcactctctgaacaatgtcccaccaagc
ccagtggtgttcttgcaaacggcaccccagctctcacccttcatccatcaccacagccag
caggtaccctactaccttgaaaatgaacagggcagctttgggatgagggaagctgctcct
ccagccttctacaggccaagctctgataataggcgccacagcattcgtgagaggatgtct
agtaccaatgagaaagggagcctgtccatggagtccaccaaggagacccggtactgtgct
gtgtgcaacgactatgcttcaggctaccactatggggtctggtcttgtgagggctgcaaa
gcttttttcaaaagaagtattcaagggcacaatgactacatgtgtcctgccactaaccag
tgtactattgacaagaacagaagaaagagttgccaggcctgccgactaagaaaatgctat
gaagtgggaatgatgaaaggtggaatccggaaagaccgcagaggcggcgaaatgatgaaa
cagaaacgtcaaagagaggaacaggattccaggaacggggaggcttcttctacagagctg
cgagctccaaccctttggacaagtccactggtggttaaacataacaagaagaacagtccg
gctctgtctctgacagcagaacagatggtcagtgccttgctggaagctgagccacctata
gtttattctgaatatgaccccaatagaccattcaacgaagcatctatgatgaccctgttg
accaaccttgcagacagagaattagtgcacatgatcaactgggcaaagagagttccagga
tttgtggatttaacactccatgatcaggtccatctgctggaatgtgcctggttagagata
ttgatgatcggcttagtctggcgctccatggaacacccaggaaagcttttatttgcacct
aatctattactggacaggaatcaagggaaatgtgtagagggcatggtggaaatctttgac
atgctactggctactgctgctcggtttcggatgatgaaccttcaaggggaggaatttgtg
tgccttaagtccatcatcctgctcaattctggtgtgtacacttttctttctagcaccttg
aaatctctggaagagagggactatatccaccgtgttctggacaaaatcacagatactctg
atacacctaatggcaaagtcaggtctttctctgcagcagcaacaccggcgactagctcag
ctcctccttatcctctctcacatcaggcatatgagcaacaaaggaatggagcacctgtac
aatatgaagtgtaaaaatgtagttccgctctacgacctcttactggagatgctggacgct
caccgcctacatgcaccggcagccaggagtgctgcaccaatggaagaggagaaccgaaac
caactgacaaccgcaccagcttcatctcattccctgcagtccttttacattaacagcaaa
gaagaggagagtatgcagaatacaatataa

DBGET integrated database retrieval system