KEGG   Gallus gallus (chicken): 396137Help
Entry
396137            CDS       T01006                                 

Gene name
GRIA4, GLUR4/D, GluR4, GluR4d
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
gga  Gallus gallus (chicken)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    396137 (GRIA4)
Ion channels [BR:gga04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   396137 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 902 aa AA seqDB search
MRIICRQLVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNRFVFLYDTDRGYSILQAIMEKAGQNSWQ
VSAICVENFNDASYRRLLEDLDRRQEKKFVIDCEIERLQNLLEQIVSVGKHVKGYHYIVA
NLGFKDISLERFMHGGANVTGFQLVDFSTPMVTKLMQRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKNTGPRKVGYWNDMDKLVLIQHEPTLGNDTSAMENRTVVVT
TILEAPYVMFKKNHDTFEGNDKFEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDPETK
IWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMKSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSPLGTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHSGTAIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggataatttgcagacagcttgtcttgttgttttctggcttttggggactagcaatg
ggagcttttcctagcagcgtgcaaataggtggtctcttcatcaggaacacagatcaggaa
tatactgcttttcgattagcaatttttcttcataacaccagccccaatgcctcggaagca
ccttttaatttggttcctcatgtagacaacattgaaacagctaacagcttcgctgtaaca
aatgccttctgctcccagtattctagaggagtttttgccatttttggactttatgataag
agatcagtacataccttgacctcattctgcagcgccttgcacatctccctcatcacacca
agtttccccactgagggtgagagtcagtttgtgctgcagctgcggccatcactgcgggga
gccctcctgagcttgctggatcactatgaatggaaccgctttgtcttcctgtatgacaca
gatcgaggttattcaatacttcaagctattatggaaaaagcaggacaaaatagctggcaa
gtcagtgccatctgcgtggagaatttcaatgatgccagctacaggcggcttttagaagac
ctggaccgaagacaagaaaagaaatttgtaatagactgtgaaatagagaggctgcagaat
ctcttagaacagattgtaagcgtgggaaagcatgttaaaggataccattacattgttgcc
aacctgggattcaaagatatttctctggagaggtttatgcatggaggagctaatgtgacg
ggatttcagctagtagatttcagtaccccaatggtaactaagttgatgcagcgctggaag
aagctggaccagagagaatacccgggatccgagaccccaccaaagtatacatctgcatta
acatatgatggagtgcttgtgatggctgaaactttccgcaatcttagaaggcaaaaaata
gatatttcaagaagaggaaatgctggtgattgtcttgctaatcctgctgctccatggggt
caaggaattgatatggagaggacattgaaacaggttcgaatacaaggattgacaggaaat
gttcaatttgaccactatggtcgcagagtcaactacactatggatgtctttgagctgaag
aacacaggtcctcggaaggttggttactggaatgacatggataaattagttctgattcag
catgaacctacacttggaaatgacacttcagccatggagaacaggactgtagttgtcact
acaattttggaagccccatatgttatgttcaagaaaaaccatgatacgtttgaagggaat
gacaagtttgaaggatactgtgtagatctggcgtcagaaattgcaaaacatattggtatc
aagtacaaaattgccattgttcctgatggaaaatatggagcaagggatccagagacaaaa
atctggaatgggatggtgggagaacttgtttatgggaaagcagagattgctgttgcgcct
ctgaccatcactttggtacgagaagaggtcattgatttttctaagccttttatgagtttg
gggatatccattatgatcaaaaagccccagaaatctaaaccaggagtgttttccttcttg
gaccctttggcgtatgagatctggatgtgcatagtctttgcctacattggtgtcagtgtg
gtcctgttcctagttagcaggtttagcccatacgagtggcatacagaagaaccagaggat
gggaaagaaggacccagtgatcagcctcccaatgaatttggcatattcaacagcctctgg
ttttccctgggtgcctttatgcaacaaggatgtgatatttccccaagatccctctcaggt
cgcattgttggaggtgtctggtggttcttcacactcatcattatttcatcctacactgct
aacctcgctgctttcttgactgttgagcgaatggtctcacccatagaaagtgcagaagac
cttgccaaacaaactgaaattgcttacgggacactggactcagggtcaaccaaagagttc
ttcagaagatcaaaaatagcagtgtatgaaaagatgtggacctacatgaaatcagcagag
ccgtcagtgttcactaggactactgcagagggagtagctcgtgtccgcaaatccaagggc
aagtttgccttcctgctggagtccaccatgaatgaatacattgagcaacgaaagccttgt
gacaccatgaaagtgggaggaaatctggattcgaaaggctatggcgtagccacaccgaag
ggttctccattaggaactcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtc
ttagacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggacccaaggactct
ggaagtaaggacaagacgagtgccttgagtctcagcaacgttgctggagtcttctacatt
ctggttggaggcttgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaggcgaaacgaatgaagcttaccttttctgaagccatacgaaacaaagccaga
ttatccatcacagggagtgtgggtgaaaatggccgcgtattgactcccgactgcccgaag
gctgtgcattccggaactgcaattagacaaagttcaggattggctgtaattgcatcggac
ctaccataa

DBGET integrated database retrieval system