KEGG   Gallus gallus (chicken): 396146Help
Entry
396146            CDS       T01006                                 

Gene name
GCH1
Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gga  Gallus gallus (chicken)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    396146 (GCH1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     396146 (GCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
5
AA seq 236 aa AA seqDB search
MAAARSCNGYARREGPPSPKLGTEKPRVSAGSGGSGDGWRGERPRSEEDNELSLPSLAAA
YTTILRALGEDPERQGLLKTPWRAATAMQFFTKGYQETIADVLNDAIFDEDHDEMVIVKN
IDMFSLCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAIAIT
EALQPAGVGVVIEATHMCMVMRGVQKMNSKTATSTMLGVFREDPKTREEFLTLIRS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgcggagctgcaacgggtacgcacggcgggagggaccgccctcccccaag
ctgggcaccgagaagccgcgtgtatccgccggtagcggcggtagcggggacgggtggcgg
ggagagcggccccgcagcgaggaggacaacgagctgagcctgcccagcctggcggccgcg
tacaccaccatcctgagggcgctgggcgaggaccccgagcggcaggggctgctgaagacg
ccctggagggcggccaccgccatgcagttcttcaccaagggctaccaggagaccatcgcg
gatgtgctgaatgatgccatctttgacgaagaccacgatgagatggtaattgtgaagaac
atagacatgttctcattgtgtgagcatcacctcgttccatttgttggaaaggtacatatt
ggctatcttcctaacaaacaagtacttggcctcagcaagctcgcgaggattgtggaaata
tacagtagaagactacaagtccaggaacgccttaccaaacaaattgcaatagccatcaca
gaagccttacagcccgctggagttggagtggtgatcgaagctacgcatatgtgtatggta
atgcgtggggtacagaaaatgaacagtaaaacggcaaccagcacaatgttgggggtattc
cgggaagacccaaagacccgtgaagagttcttgacgctcatcaggagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system