KEGG   Gallus gallus (chicken): 396186Help
Entry
396186            CDS       T01006                                 

Gene name
BDNF
Definition
(RefSeq) brain derived neurotrophic factor
  KO
K04355  brain-derived neurotrophic factor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    396186 (BDNF)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   396186 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 396186
NCBI-ProteinID: NP_001026787
CGNC: 9230
Ensembl: ENSGALG00000012163
UniProt: P25429 K4MNE5
Position
5
AA seq 246 aa AA seqDB search
MTILFLTMVISYFSCMKAAPMKEASVRGHGSLAYPGLRTHGTLESLTGPNAGSRGLTSLA
DTFEHVIEELLDEDQDIQPSEENKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAAN
MSMRVRRHSDPARRGELSVCDSTSEWVTAAEKKTAVDMSGATVTVLEKVPVPKGQLKQYF
YETKCNPKGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDNKKRVGWRFIRIDTSCVCTL
TIKRGR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatctcatacttcagttgcatgaaagctgccccg
atgaaagaagctagtgtaagaggacatggcagcttggcttacccaggtcttcggacccac
gggactcttgaaagcctaactgggcccaatgctggttcaagaggactgacatcactggcg
gacacttttgaacacgtgatagaggagcttctagatgaagatcaggacatccagcccagt
gaggaaaacaaggatgcggacttgtacacatcccgagtcatgctgagcagtcaagtgcct
ttggaacccccactgctctttctgctcgaggagtacaaaaactacctggatgctgcaaac
atgtccatgagagtccggcgtcactctgacccagctcgccgtggggaactgagcgtctgt
gacagcacaagcgagtgggtaacagcagcggagaaaaagactgcagtggacatgtctggt
gcaactgtcacagtccttgaaaaagtcccagtacctaaaggccaactgaagcaatacttc
tatgagaccaaatgcaaccccaaggggtacacaaaggaaggctgcaggggcatagacaag
aggcactggaactcacagtgccgaactacccagtcttacgtgagagctctcaccatggat
aacaaaaagagagttggctggcggtttataagaatagacacttcctgtgtatgtacatta
accattaaaaggggaagatag

DBGET integrated database retrieval system