KEGG   Gallus gallus (chicken): 396218Help
Entry
396218            CDS       T01006                                 

Gene name
LYZ, LYZC
Definition
(RefSeq) lysozyme (renal amyloidosis) (EC:3.2.1.17)
  KO
K13915  
lysozyme C [EC:3.2.1.17]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     396218 (LYZ)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   396218 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Structure
PDB: 
2VB1 3LZT 1IEE 4LZT 3WL2 4YEO 4MWK 4B4E 3AJN 4NG8 4NGJ 4B0D 4AXT 1LKS 4MWM 4OXE 1WTN 1V7T 1V7S 5F14 4B49 2Z18 2Z19 2Z12 2D4K 2D4I 2D4J 3ATN 3ATO 2ZYP 4HP0 4HPI 5F16 5EBH 4N8Z 4HTK 4H8X 4H8Y 4H8Z 4H90 4H91 4H92 4H93 4H94 4H9A 4H9B 4H9C 4H9E 4H9F 4H9H 4H9I 4B4I 3AGI 3D9A 2HUB 1QIO 4LYB 4BAP 5DLA 4RDS 4XAD 4B4J 2D6B 4C3W 2XBR 5HMJ 4HTN 3P64 2HU3 1WTM 193L 4NHI 4XN6 4NGY 4LYC 4BAD 3RU5 2CGI 2BPU 3P66 4NGW 2XBS 5DL9 4XYY 4QEQ 3N9E 4HTQ 3N9A 3A8Z 1RJC 194L 4OWE 4NHP 4MWN 3ZEK 4TWS 3A90 1SQ2 1HF4 3WMK 2FBB 4YEM 4OWH 4NEB 3QE8 3AGH 3EXD 5D5F 4W96 4CJ2 4NGK 4E3U 4AGA 4A7D 3AZ6 3N9C 3A92 3A95 3B72 1ZVH 1XFP 1VDQ 1VAU 1A2Y 1AKI 1LZB 4BAF 2W1L 4NGL 2X0A 3WW5 3WW6 3TXD 1LZ8 4WLD 4J7V 2PC2 5FCP 4Z98 4XEN 4WM3 4W94 4N9R 4DD2 3QNG 3A91 3A93 3A94 3E3D 3WVY 2HTX 3WVX 4NWE 4NGO 5A3Z 3TXB 3KAM 4WLT 4WLX 4WM1 4WM2 4WM4 4WM5 4P2E 4DD7 4DD9 3TXI 3P68 3P4Z 3AGG 3IJU 2ZQ3 2F2N 2B5Z 1YIL 1T3P 1VDS 1VAT 1GPQ 1B2K 1LKR 1LZA 4WLY 4OWC 3AZ4 2YVB 4NFV 2HU1 1ZVY 1IR8 1LCN 4NGV 1H6M 1DPW 4NWH 4NHT 3ULR 3QY4 3A34 3EMS 2F4G 2F30 1W6Z 1DPX 4J1B 2A7D 4UWN 4B1A 2XJW 4OWB 3TXF 3TXH 5HLL 5APC 5APD 5APE 5APF 5D5C 4WG7 4WG1 4R6C 4NSJ 4NGZ 4NGI 4N1C 4BS7 4DD0 4DD1 4DD3 4DD4 4DD6 3TXE 3TXG 3IJV 2W1X 2Q0M 2AUB 1YQV 1T6V 1VDP 1VDT 1F10 1LZN 1LZ9 1BGI 1LSM 1LSA 1LSB 1LSC 1LSD 1LSE 1LSF 1HEL 4D9Z 1KXX 4PRQ 4LFP 1H87 1LYS 4PPO 2W1Y 3RT5 3A96 2H9J 2H9K 1YIK 1IOT 1G7J 1UIH 1RFP 1LMA 1HEW 1IOR 1IOS 1UIA 1UIB 4UWV 3W6A 1GWD 4UWU 2W1M 1N4F 1FN5 1FLU 4J1A 1IOQ 1KXY 5B05 5B06 5B07 4XJB 4XJD 4XJF 4XJG 4WOA 4OOT 4OWA 4GCB 4DT3 4DDC 3SP3 3RZ4 2XTH 3A6B 3A6C 3A67 2WAR 2I25 2DQJ 2DQC 2DQD 1YKZ 1J1X 1J1O 1J1P 1NBY 1LJF 1LJH 1G7I 1FLQ 1BWH 1BWI 1BVX 1BWJ 1AZF 1AT6 1AT5 5LYM 1LZC 1LZD 1LZE 1LZG 1VFB 132L 1HEM 1HEN 1HEO 1HEP 1HEQ 1HER 4PHI 3OJP 1FLW 4NG1 4HSF 3OK0 1HC0 4EOF 1FLY 2G4P 2G4Q 1B0D 5F9U 4Z46 4WM6 4WL6 4NY5 3RW8 2A7F 1RI8 1UC0 1NBZ 1G7H 1UIF 1KIQ 4NIJ 4GN4 4GN5 4FJR 3RNX 4II8 4ZIX 4Z41 5C6I 4RW1 4RLM 4N0J 4ET8 4ET9 4ETD 3TMU 3TMV 3TMW 3TMX 3A3R 2EIZ 2I6Z 2DQE 1Z55 1YKX 1YKY 1YL0 1YL1 1VED 1UA6 1NDG 1LJG 1IR7 1IR9 1JIS 1JIT 1JIY 1JJ0 1JJ1 1JJ3 1G7M 1F0W 1HSX 1LSY 1LSN 1RCM 3LYT 4LYT 5LYT 6LYT 4ETA 4ETB 4ETC 4ETE 4TSC 4NHQ 4TUN 3LYO 2LYO 1LYO 5F9X 4R0F 4ZEE 4WL7 4TSB 4GN3 3M18 2F4A 1LJ4 1UIC 1UID 1UIE 1UIG 4ZFP 4LGK 1KXW 2LZT 1LZT 4WO9 4NHS 4MR1 4YEN 4XJH 4XJI 4WO6 3WXT 3WXU 3WUL 3WUM 3WU7 3WU8 3WU9 3WUA 3WPJ 3WPK 3WPL 4NSG 4M4O 4LT2 4LT3 4KXI 4IAT 4I8S 4GCC 4G4C 4G4H 3ZVQ 2YDG 2YBH 2YBI 2YBJ 2YBL 2YBM 2YBN 3A3Q 2ZQ4 2EKS 2DQI 1ZV5 1PS5 1P2C 1LJE 1LJI 1LJJ 1LJ3 1IO5 1G7L 1DQJ 2CDS 1HSW 1LPI 1KIR 1UCO 1LSZ 2LYM 3LYM 1LYZ 2LYZ 3LYZ 4LYZ 5LYZ 6LYZ 1C10 1QTK 4QY9 4LYO 4O34 5C6J 5C6L 4YOP 4YM8 4X3B 4OW9 4NSH 4N5R 4LT0 4LFX 4G4B 3AZ7 3AW6 3AW7 3P65 2D91 1XGP 1XGQ 1XGR 1XGT 1XGU 1NDM 1LJK 1JTT 1IC7 1XEI 1XEJ 1JPO 1KIP 4LYM 5F81 4Z3M 4TTD 4OOO 4RLN 4PRU 3G3A 3T6U 4N1E 4U3X 4TSA 5DM9 4RW2 4NSI 4LT1 4HV1 4H1P 2ZNX 3B6L 2DQH 2DQG 1IC5 1C08 1XEK 3AZ5 3M3U 3WUN 4G49 4G4A 3G3B 2YSS 1LSG 4DDA 3TXJ 5A3E 4WMG 3J6K 4HV2 3F6Z 2EPE 2I26 2DQF 1JTO 1IC4 1MEL 1MLC 1FDL 9LYZ 8LYZ 7LYZ 4QGZ 4GLV 4PGJ 4IAS 4DC4 2IFF 4M6D 1BVK 2ZNW 4GLA 4GCD 3J4G 4GCE 4DDB 3TXK 1ZMY 3HFM 4GCF 3OTP 1BHZ 1LZH 2LZH 4A8B 4A8A 2HSO 2HS7 2HS9 2C8O 2C8P 2A6U 2BLX 2BLY 1SF4 1SF6 1SF7 1SFB 1SFG 1UUZ 1GXX 1GXV 1JA2 1JA4 1JA6 1JA7 1E8L
Thumbnails

Jmol
Position
1
AA seq 147 aa AA seqDB search
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCVAKFESNFNTQA
TNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDG
NGMSAWVAWRNRCKGTDVQAWIRGCRL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctttgctaatcttggtgctttgcttcctgcccctggctgctctggggaaagtc
tttggacgatgtgagctggcagcggctatgaagcgtcacggacttgataactatcgggga
tacagcctgggaaactgggtgtgtgttgcaaaattcgagagtaacttcaacacccaggct
acaaaccgtaacaccgatgggagtaccgactacggaatcctacagatcaacagccgctgg
tggtgcaacgatggcaggaccccaggctccaggaacctgtgcaacatcccgtgctcagcc
ctgctgagctcagacataacagcgagcgtgaactgcgcgaagaagatcgtcagcgatgga
aacggcatgagcgcgtgggtcgcctggcgcaaccgctgcaagggtaccgacgtccaggcg
tggatcagaggctgccggctgtga

DBGET integrated database retrieval system