KEGG   Gallus gallus (chicken): 396219Help
Entry
396219            CDS       T01006                                 

Gene name
LPL
Definition
lipoprotein lipase (EC:3.1.1.34)
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    396219 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    396219 (LPL)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     396219 (LPL)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   396219 (LPL)
  Exosomal proteins of breast milk
   396219 (LPL)
Heparan sulfate/heparin binding proteins [BR:gga00536]
 Enzymes (General comment) Variety
  396219 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
Z
AA seq 490 aa AA seqDB search
MERGRGMGKTALLAVLCLCLRGAAGSDPEAEMNFEGIESKFSLRTPAEPDEDVCYLVPGQ
MDSLAQCNFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLVRAQQH
YPVSAAYTKLVGKDVAMFIDWMEEKFNYPLNNVHLLGYSLGAHAAGIAGSLTKKKVNRIT
GLDPAGPTFEYADAPIRLSPDDADFVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQ
PGCNLGEALRLIAEKGFSDVDQLVKCSHERSIHLFIDSLLYEEKPSMAYRCNTKEAFEKG
LCLSCRKNRCNNLGYKVNRVRTKRNTKMYLKTRAQMPYKVFHYQVKIHFFGKTNVTKVDQ
PFLISLYGTLDESENIPFTLPEVSSNKTFSFLIYTEVDIGDLLMLKLQWEKDTFFSWSDW
WTPFAFTIQRVRVKSGETQKKVVFCSRDGSSRLGKGEEAAIFVKCLEQPVSRKRGGAKKA
SKENSAHESA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaggacgcgggatggggaagacagcgctgctggctgtgctgtgcctctgcctg
cgcggggccgccggctccgatcccgaagctgagatgaattttgagggaatcgagagcaag
ttttccttaagaacacctgcagagcctgatgaagatgtctgctacctggttcctggacag
atggacagcttggcacagtgcaacttcaaccataccagtaaaacctttgtggtgatccat
gggtggacggtgacaggaatgtatgaaagctgggtcccaaagctagtggatgctctgtac
aagagggaacctgattcaaatgtcattgttgtggactggctggttcgagctcagcagcac
tacccagtgtctgctgcttacacgaagctggtgggaaaggatgttgccatgttcattgat
tggatggaggagaaattcaattaccctctcaacaatgtccacttgctggggtacagtctg
ggtgctcatgctgctgggattgctggaagtttaaccaagaaaaaggtgaacagaattact
ggtctggatcctgctggtcccacctttgagtatgctgatgcccctatccgcctctccccg
gatgatgctgactttgtggatgtcctgcacacctacactcgaggctctccagatcgcagc
attgggattcagaagcctgttggacacattgatatctaccctaatggtggaggtttccag
ccaggctgcaacttgggagaagctctccgcctgattgctgaaaaaggcttttcagatgtg
gatcagctggtgaagtgctctcatgaacgatccatccatctcttcattgactcactcctc
tatgaagagaagcccagcatggcctaccgctgcaacacaaaagaggcctttgagaagggc
ctctgcctaagctgccggaagaaccgttgcaacaacttgggttataaagtcaacagagtg
agaacaaagagaaacaccaaaatgtacttgaagacccgtgctcagatgccctacaaagtc
ttccattatcaggtcaagatacatttctttggaaagacaaatgtgaccaaggtagaccag
ccattcctgatctctctgtatggcactctagacgagagtgagaacattcctttcacgctg
cctgaagtctcttccaacaagaccttctccttcctgatctacacagaagtggacattggt
gacctgcttatgctaaagctgcagtgggagaaagatactttcttcagctggtcagactgg
tggactccatttgcattcaccattcagagagtcagagtgaagtcaggcgaaactcagaaa
aaggtggtattctgttctcgagatggcagctcacgtcttggtaaaggagaagaggcagca
atatttgtgaagtgcctggagcagcctgtcagcaggaagaggggaggtgccaagaaagcc
tctaaagaaaattctgcacacgagtctgcttaa

DBGET integrated database retrieval system