KEGG   Gallus gallus (chicken): 396219Help
Entry
396219            CDS       T01006                                 

Gene name
LPL
Definition
lipoprotein lipase (EC:3.1.1.34)
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gga00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:gga03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
Z
AA seq 490 aa AA seqDB search
MERGRGMGKTALLAVLCLCLRGAAGSDPEAEMNFEGIESKFSLRTPAEPDEDVCYLVPGQ
MDSLAQCNFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLVRAQQH
YPVSAAYTKLVGKDVAMFIDWMEEKFNYPLNNVHLLGYSLGAHAAGIAGSLTKKKVNRIT
GLDPAGPTFEYADAPIRLSPDDADFVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQ
PGCNLGEALRLIAEKGFSDVDQLVKCSHERSIHLFIDSLLYEEKPSMAYRCNTKEAFEKG
LCLSCRKNRCNNLGYKVNRVRTKRNTKMYLKTRAQMPYKVFHYQVKIHFFGKTNVTKVDQ
PFLISLYGTLDESENIPFTLPEVSSNKTFSFLIYTEVDIGDLLMLKLQWEKDTFFSWSDW
WTPFAFTIQRVRVKSGETQKKVVFCSRDGSSRLGKGEEAAIFVKCLEQPVSRKRGGAKKA
SKENSAHESA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaggacgcgggatggggaagacagcgctgctggctgtgctgtgcctctgcctg
cgcggggccgccggctccgatcccgaagctgagatgaattttgagggaatcgagagcaag
ttttccttaagaacacctgcagagcctgatgaagatgtctgctacctggttcctggacag
atggacagcttggcacagtgcaacttcaaccataccagtaaaacctttgtggtgatccat
gggtggacggtgacaggaatgtatgaaagctgggtcccaaagctagtggatgctctgtac
aagagggaacctgattcaaatgtcattgttgtggactggctggttcgagctcagcagcac
tacccagtgtctgctgcttacacgaagctggtgggaaaggatgttgccatgttcattgat
tggatggaggagaaattcaattaccctctcaacaatgtccacttgctggggtacagtctg
ggtgctcatgctgctgggattgctggaagtttaaccaagaaaaaggtgaacagaattact
ggtctggatcctgctggtcccacctttgagtatgctgatgcccctatccgcctctccccg
gatgatgctgactttgtggatgtcctgcacacctacactcgaggctctccagatcgcagc
attgggattcagaagcctgttggacacattgatatctaccctaatggtggaggtttccag
ccaggctgcaacttgggagaagctctccgcctgattgctgaaaaaggcttttcagatgtg
gatcagctggtgaagtgctctcatgaacgatccatccatctcttcattgactcactcctc
tatgaagagaagcccagcatggcctaccgctgcaacacaaaagaggcctttgagaagggc
ctctgcctaagctgccggaagaaccgttgcaacaacttgggttataaagtcaacagagtg
agaacaaagagaaacaccaaaatgtacttgaagacccgtgctcagatgccctacaaagtc
ttccattatcaggtcaagatacatttctttggaaagacaaatgtgaccaaggtagaccag
ccattcctgatctctctgtatggcactctagacgagagtgagaacattcctttcacgctg
cctgaagtctcttccaacaagaccttctccttcctgatctacacagaagtggacattggt
gacctgcttatgctaaagctgcagtgggagaaagatactttcttcagctggtcagactgg
tggactccatttgcattcaccattcagagagtcagagtgaagtcaggcgaaactcagaaa
aaggtggtattctgttctcgagatggcagctcacgtcttggtaaaggagaagaggcagca
atatttgtgaagtgcctggagcagcctgtcagcaggaagaggggaggtgccaagaaagcc
tctaaagaaaattctgcacacgagtctgcttaa

DBGET integrated database retrieval system