KEGG   Gallus gallus (chicken): 396225Help
Entry
396225            CDS       T01006                                 

Gene name
ITGA8
Definition
integrin, alpha 8
Orthology
K06584  
integrin alpha 8
Organism
gga  Gallus gallus (chicken)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    396225 (ITGA8)
   04514 Cell adhesion molecules (CAMs)
    396225 (ITGA8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    396225 (ITGA8)
  Cell communication
   04510 Focal adhesion
    396225 (ITGA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
2
AA seq 1044 aa AA seqDB search
MPRRQPPRPLLLLSALLCAPASAFNLDEEKLTVYSGPPGSYFGYSVDFYIPDPSTVSVLV
GAPRANTTQPDIVEGGAVYHCGWPAARCRQIPFDNTNNRKIKVNGTREPIEFKTNQWFGA
TVKAHKEKVVACAPLYHWRTLKDSPEKDPVGTCYVAIQNFSAYAEYSPCRNSNADPEGQG
FCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASIADIITNYSFKDILRKLAHEKQTGVA
PPTYDDNYMGYSVAAGEFTGDSEEELVAGVPRGAQNFGYVSIINSSDLTFIQNFTGEQMA
SYFGYTVAVSDVNNDGLDDILVGAPLFMEREFESKPKEVGQVYLYLQESAFLFRDPQILT
GTEVFGRFGSAITHLGDLNQDGYNDIAVGAPFAGEDRRGKVLIYNGYSNGLKTDPSQVLN
GAWASQSMPSGFGFTLRGDSDVDKNDYPDLIVGAFGAGKAVVYRARPVVTVNALLILNPM
IVNPDNKTCQPPGSPLFVACFTVRVCAAFEGQSISDEIVLKGELQLDSLKQKGAVKRTLF
FDYHQSHHYFSIVMERQKKLYCQDFLVYLRDETEFRDKLSPININLNYSLDESHFKDSLL
VKPILNYYQRPSVTEQAYILVDCGEDNLCIPDLHLSAVPDKDQLIIGEENCVMLIINPRN
DGEGAYEAELHIKIPPEADYTGVERNNKALRVLSCDYKMENETRMVVCDLGNPMVAGANF
STGIRFSVQHFENSDFSINFELQIKSSNKINSTSNLVNLHINITAAAQVQVRGVSHPPQI
ILPLHNWEPKDEPTKEEEIGPLVEHIYELHNIGPSAINNTVLHVGWPVSSGEEFLLYILH
IQTHGPLHCQTSSPINIMQINFAIPQDTPELAAFLYNSTISHYIRRREVAVAEPYRRNSA
KILNCTNVKCILISCNVGQLERGKSAALKIRSRLWAETFLQRKNDPYTLSSNVSFKVKNM
PYKVQPAKLPEGSIAIRTSVIWSTPNVSFVIPLWVIILAIMLGLLVLAVLTLALWKCGFF
DRARPPQDDMADREQLTNNKTTDA
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccggcagccgccgcgcccgctgctcctcctgtcagccctgctctgcgcgccg
gcgtcggccttcaacctggacgaggagaagctgacggtgtacagcgggccgcccggcagc
tacttcgggtactcggtggacttctacatccccgaccccagcacggtcagcgtcctggtg
ggagctccccgagccaacaccacgcagccggacatcgtggaaggaggagcggtgtaccac
tgcggctggccggccgcgcgctgcaggcagatccccttcgataacacgaacaacaggaaa
attaaagtcaatggcaccagagaaccaattgaatttaagacaaatcagtggtttggggca
acagtcaaagctcataaagaaaaagttgtggcttgtgctcccttatatcattggaggact
cttaaagacagcccagagaaggaccccgttggcacctgctatgtagcaattcagaacttc
agtgcctatgctgaatactcaccttgtcgcaacagcaatgcagatcctgaaggacagggc
ttttgccaagcaggtttcagcttagatttttacaagaatggagacctcatagtaggcggg
cctggtagtttttattggcaaggtcaggtaatcactgcaagcattgcggatatcatcaca
aattattccttcaaggatattctgaggaaactggcacacgagaagcaaacaggagttgca
ccacccacatatgatgacaactatatgggatactcagtagctgctggggaatttactgga
gattctgaagaagagctggttgctggagtcccaaggggtgcccagaactttggctatgtc
tcaatcattaattcttcagacttgaccttcatccagaatttcactggtgagcagatggca
tcttattttgggtacactgttgcagtatctgatgttaacaatgatggtttagatgatatc
ttagttggggcccctctgtttatggaacgagaatttgagagcaagcctaaagaagttgga
caagtctatctgtacctgcaggaaagtgctttcctcttccgagatccgcaaattctgaca
ggcactgaagtgttcggtagatttggcagtgcaatcactcaccttggagatctcaatcag
gatggatataatgacattgccgttggtgcaccgtttgcaggtgaagacagaagaggtaaa
gtgctcatttacaatggatacagtaatgggttaaaaactgacccttcccaggttctcaat
ggagcctgggcctcacagtccatgccttcgggatttggcttcactctaagaggagactca
gatgtagacaagaatgattacccagatttaattgtgggtgcgtttggagctggaaaagca
gttgtttacagagccagacctgttgtgaccgtgaatgctctgctcattctgaaccccatg
attgtgaatccagacaacaagacttgtcagccccctggctctccgcttttcgtggcctgt
tttactgtaagagtgtgtgcagcatttgaaggccaaagtatttcagatgagatagtgctg
aaaggtgaattgcaattagattcattgaaacagaaaggagctgttaaaaggactctcttc
tttgattaccatcagtcacatcattatttctccattgtgatggaaagacagaagaagctc
tattgccaggactttcttgtttatctcagagatgaaacagaatttagagataaattatct
cccatcaatataaacttgaattatagcttggatgaatcccatttcaaagatagcttgttg
gtgaagccaatactgaattattaccagagaccctcagtaacggaacaggcttacattctg
gtagattgcggggaggacaacttgtgcattcctgacttgcacctttctgctgtgccagat
aaagatcagctaataattggagaagaaaactgtgtcatgctcataataaatccaaggaat
gatggggaaggagcctatgaagctgagctgcatataaagattccacctgaagcagattac
actggggttgaacgcaacaacaaggcactgcgtgtgttgagctgtgattacaagatggaa
aatgaaactagaatggtggtttgtgatcttgggaaccccatggtggctggcgcaaatttc
tctacaggtatccggttttctgttcagcattttgagaattcagacttcagcatcaatttt
gagctgcaaataaaaagttctaacaagattaattccaccagcaatttagttaaccttcat
atcaacatcaccgctgcggctcaagtgcaggtcagaggagtctctcacccaccacaaatt
attctgcctcttcacaactgggaacccaaagatgaacctaccaaagaagaagaaattggt
ccattagttgaacacatctatgagcttcacaatataggaccaagtgccatcaacaataca
gttctccatgtcggttggcctgtgtccagtggagaagagtttcttctttacattctccat
attcagacgcatggaccgttgcactgtcaaacaagttctcctattaatatcatgcaaatc
aattttgctattccgcaggacactcctgaacttgctgcttttttatataattccacaatt
tctcattacatcaggagaagggaggtagccgtggcagaaccttacaggaggaactctgca
aaaatactgaactgtacaaatgtgaagtgtatcctaatttcctgcaatgtgggacaactg
gaaagagggaagagcgcagcactgaaaatcaggtcccggctatgggctgaaactttcctg
cagaggaaaaatgatccctatactctttcttccaatgtgtccttcaaagttaagaacatg
ccctataaagtgcagccagcgaagctccccgagggaagcatagcaatcagaacatcagtc
atttggtccactccaaatgtctcctttgtcatccctttgtgggttataatactagcaata
atgcttggtctactggtactagcggtgttgacccttgctttatggaagtgcggcttcttt
gacagagctagaccccctcaagatgacatggcagacagagaacaactgacaaataacaag
actactgatgcatag

DBGET integrated database retrieval system