KEGG   Gallus gallus (chicken): 396237Help
Entry
396237            CDS       T01006                                 

Gene name
MYO5A, GS1, MYH12, MYO5, MYR12, myosin-12, myoxin
Definition
(RefSeq) myosin VA
  KO
K10357  
myosin V
Organism
gga  Gallus gallus (chicken)
Brite
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Cargo complex
     396237 (MYO5A)
   mRNA cycle factors
    P-body specific factors
     396237 (MYO5A)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    396237 (MYO5A)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     396237 (MYO5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10
AA seq 1829 aa AA seqDB search
MAASELYTKYARVWIPDPEEVWKSAELLKDYKPGDKVLQLRLEEGKDLEYCLDPKTKELP
PLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYG
EDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMR
TYLLEKSRVVFQAEEERNYHIFYQLCASAALPEFKTLRLGNANYFHYTKQGGSPVIDGID
DAKEMVNTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDSDSCAIPPKHDPLTIF
CDLMGVDYEEMAHWLCHRKLATATETYIKPISKLHAINARDALAKHIYANLFNWIVDHVN
KALHSTVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKE
QIPWTLIDFYDNQPCINLIEAKMGVLDLLDEECKMPKGSDDTWAQKLYNTHLNKCALFEK
PRLSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKKFKLLPELFQDEEKAI
SPTSATPSGRVPLSRTPVKPAKARPGQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVR
CIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDV
LSDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRAACIRIQKTIRG
WLMRKKYMRMRRAAITIQRYVRGHQARCYATFLRRTRAAIIIQKFQRMYVVRKRYQCMRD
ATIALQALLRGYLVRNKYQMMLREHKSIIIQKHVRGWLARVHYHRTLKAIVYLQCCYRRM
MAKRELKKLKIEARSVERYKKLHIGLENKIMQLQRKIDEQNKEYKSLLEKMNNLEITYST
ETEKLRSDVERLRMSEEEAKNATNRVLSLQEEIAKLRKELHQTQTEKKTIEEWADKYKHE
TEQLVSELKEQNTLLKTEKEELNRRIHDQAKEITETMEKKLVEETKQLELDLNDERLRYQ
NLLNEFSRLEERYDDLKDEMNLMVSIPKPGHKRTDSTHSSNESEYTFSSEITEAEDLPLR
MEEPSEKKAPLDMSLFLKLQKRVTELEQEKQSLQDELDRKEEQALRAKAKEEERPPIRGA
ELEYESLKRQELESENKKLKNELNELQKALTETRAPEVTAPGAPAYRVLLDQLTSVSEEL
EVRKEEVLILRSQLVSQKEAIQPKEDKNTMTDSTILLEDVQKMKDKGEIAQAYIGLKETN
RLLESQLQSQKKSHENELESLRGEIQSLKEENNRQQQLLAQNLQLPPEARIEASLQHEIT
RLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNI
PRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPGLPAYILFMCVRHADYLNDD
QKVRSLLTSTINGIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTPRQN
EHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQPMIVSGMLEHETIQGVSGVKPTGL
RKRTSSIADEGTYTLDSIIRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAVTLNNLLL
RKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDEDAEA
ICSMCNALTTAQIVKVLNLYTPVNEFEERVLVSFIRTIQLRLRDRKDSPQLLMDAKHIFP
VTFPFNPSSLALETIQIPASLGLGFISRV
NT seq 5490 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctccgagctgtacaccaagtatgccagggtttggatccctgacccagaggag
gtctggaagtcagcagaacttcttaaagattataaacctggagataaagttttgcagctt
cgacttgaagagggcaaggacctagaatattgcctcgaccccaagactaaggaactcccc
cccttgcgaaaccctgacatccttgttggtgaaaatgacctcactgcgctcagttatctc
catgaacctgctgtgctacacaacctcaaagttcgatttatagactctaaactcatttat
acctattgtggtatcgtcttagtggcaataaacccttatgaacagctgcctatctatggc
gaagatatcatcaatgcgtacagtggccaaaatatgggggatatggatccacatatcttt
gcagtggcagaagaggcatacaagcagatggccagagatgagcgaaatcagtcaatcatt
gtaagtggagaatctggggcaggaaagacggtttctgccaagtatgccatgaggtacttt
gccacggtcagtggatctgccagtgaagccaatgttgaggagaaagtcttggcttcaaac
cccataatggagtccattggaaatgccaaaacaacgaggaatgacaacagcagtcgcttt
gggaaatacattgaaattggttttgacaagaggtatcgaatcattggtgctaacatgaga
acttatctcttggagaaatcaagagtggtatttcaggcagaagaggagaggaattaccac
atcttttaccaactctgtgcctctgcagcattacctgaatttaaaactctacgattaggg
aatgcaaattactttcattatacaaagcaaggtggaagccctgtgattgatggcattgat
gatgctaaggaaatggtaaacaccagacaagcctgcactttgctagggattagtgattcc
taccagatgggaattttccgaatccttgctggcatccttcacttgggcaacgtggagttt
gcatctcgggattctgacagctgcgccattcctcccaaacatgatcccctcaccatcttc
tgtgacctcatgggcgtggactatgaagagatggctcactggctttgccataggaagctc
gcaactgccactgaaacctacatcaagccaatttctaaacttcatgccatcaatgccaga
gatgcacttgccaaacatatctatgctaatctctttaactggattgtagatcatgtgaac
aaagcccttcattctactgtaaagcaacattctttcattggagtactggacatttatgga
tttgagacatttgaaatcaacagcttcgaacagttctgtatcaactatgccaatgagaaa
ctgcagcagcagttcaatatgcatgtgtttaagctggaacaagaagaatacatgaaagaa
caaataccatggaccttgattgatttctatgacaatcagccttgcatcaacctcatagaa
gccaaaatgggagttctggatctgttagatgaggaatgcaagatgccaaaaggctcggat
gacacttgggcccaaaaactgtacaatactcatttgaataaatgtgccctctttgaaaaa
ccacgtttatccaataaggcttttatcatcaaacactttgctgacaaggtggaatatcag
tgtgaaggctttctggaaaagaataaggatacagtttatgaagagcaaattaaggtccta
aaatcaagtaagaagtttaagctgctaccagaattattccaggatgaggagaaggccatc
agtcccacgtcagccaccccttcaggccgtgtgccattgtctcgaactcctgtaaaacca
gccaaggccaggccaggtcaaactagcaaggagcataagaaaactgtggggcatcagttt
cgaaactctcttcatctgctgatggaaaccctgaacgccacaactccacactatgtgcgc
tgtattaagcctaacgacttcaagtttccattcacatttgacgaaaagcgagcagtgcag
cagctgagagcttgtggtgtcctggagaccatccgaatcagtgcagctggtttcccctcc
aggtggacgtaccaagagttcttcagccgttaccgtgttctcatgaagcagaaagatgtc
cttagtgaccgaaaacagacatgtaaaaatgtcctggagaagctgattctggacaaggat
aagtaccagtttggtaagacaaaaatatttttccgggctggtcaagtagcctatcttgaa
aaaataagggcagataagttgagagctgcctgtatccgcatccaaaagacaatccgaggc
tggctgatgagaaagaagtacatgcgtatgaggagggctgccatcaccattcagagatat
gtcagagggcaccaagcacgatgctatgccacattcctgcggagaacacgggctgccatc
attattcagaagttccagcgtatgtatgtggtccgcaaaagataccagtgcatgcgagat
gctactattgctcttcaagctctcttaagaggttacctggtcaggaacaagtaccaaatg
atgcttcgagagcacaagtctattattattcagaaacatgtaagaggctggctggctcga
gtgcactatcataggaccttgaaggcaattgtttacttgcaatgctgttaccggcgcatg
atggccaagagggagctgaagaagctgaagatagaggctcggtctgtggaacgctacaag
aagcttcacattggcttggagaacaagatcatgcagctgcagcggaaaattgatgaacag
aacaaagagtacaaatctctgctggagaagatgaataacctggagatcacatacagtaca
gagacagagaagcttcggagtgatgtggagaggcttcggatgagtgaggaggaggctaag
aatgcaaccaaccgtgttctcagccttcaggaagagattgccaagctccggaaggagctg
caccagactcagactgagaagaagacaattgaggaatgggcagacaaatacaaacatgaa
actgagcagctggtgtcggaactgaaagagcagaacacattactgaaaacagaaaaggag
gagctgaaccgccgtatccatgaccaagcaaaggagataacagagacaatggagaagaag
ctagtggaggaaacaaagcagttggagctagacctgaacgatgagaggttacggtatcag
aacctgctgaatgagttcagccgcttggaggagcggtatgatgatctcaaggatgaaatg
aacttaatggtgagcatccccaagcctggacacaaaagaacggattcaactcacagtagc
aatgaatctgaatatacttttagctctgagatcacagaagcagaagacttaccactgagg
atggaggagccaagtgagaaaaaggcaccattggacatgtctctgttcctcaagctgcag
aaacgggttacagagctggagcaagaaaagcaatccctgcaggatgaactggacagaaag
gaagaacaggctcttcgtgccaaagctaaggaggaggaaaggcctccaataagaggtgca
gagttggagtatgagtcgctcaagcgtcaagagcttgaatctgagaataaaaaactgaag
aatgagttgaacgagctgcagaaggccctcacagaaacacgagctccagaggtaactgct
cctggtgctccagcatacagagtcctcctggatcagctgacttcagtaagcgaagaactg
gaagtacgcaaggaagaagtgcttatcctgaggtctcagttggttagccagaaagaggct
attcaacccaaggaggacaagaacaccatgacagattctacaatcctcttggaggatgtg
cagaagatgaaagacaaaggggaaatagcacaggcgtatattggactgaaggaaaccaac
aggctgctggagtctcagctgcagtcgcagaagaagagccacgagaatgagctggagtca
ctgcgaggtgagatccaaagtctgaaggaagaaaacaatcgccagcagcagctcttggca
cagaatctgcagctgcccccggaggcccgcattgaagccagtctgcagcatgagatcacc
cggctgacaaacgagaacttggatttaatggaacaacttgaaaagcaagacaaaactgtt
cgcaaattaaagaagcaattgaaggtatttgctaagaagattggtgaacttgaagtgggt
cagatggagaacatatcacctggacaaatcattgatgaacctattcgtccagttaacatt
ccacggaaggaaaaggacttccaggggatgttggagtataagaaagaggatgaacaaaag
ctagtcaagaatcttatattagagctgaaaccacgcggggtagcagtcaacctgattcca
ggactaccagcatatattttgttcatgtgtgtacgccacgcagattaccttaacgatgac
cagaaagtgcgttcattgttgacctccactatcaatggcatcaaaaaagtgctgaagaaa
agaggtgatgacttcgaaacggtgtctttctggctgtccaacacctgccggtttttgcac
tgtttgaagcagtacagcggagaagaggggtttatgaagcataatacacctcgtcagaat
gagcactgcctcactaattttgacttagctgaatacagacaagtcctgagtgacttggct
attcagatctaccagcaactggtccgcgtgttggagaacattctgcaacccatgattgtt
tctggaatgctggagcacgagactatccagggtgtctcaggggtgaaaccaacagggctg
cggaagagaacatccagcattgctgatgaaggaacctacactttggactccattattcga
cagttgaactctttccattccgtgatgtgtcagcatggaatggatccagagctgatcaaa
caggttgtcaagcagatgttctacatcattggggctgtaacacttaataatcttctcctg
cgcaaggacatgtgttcatggagcaaaggaatgcagataaggtacaatgtgagtcaactt
gaagaatggctacgtgataaaaatctaatgaacagtggggccaaagaaacactggagccc
ctcatacaggctgcacagttgttgcaagtgaaaaagaaaacagatgaagatgcagaagcc
atttgttcaatgtgcaatgcactgactactgcccagattgtgaaagtactgaatttgtat
actccagttaatgaatttgaagagagagtcttggtatcgtttatacgtacaatacagctg
cgtctgcgagacaggaaggactctcctcaactgctcatggatgctaaacacatctttcct
gttacttttccatttaatccatcctccctggcattagaaaccatccagatcccagccagt
ttggggctgggtttcatatcacgtgtctga

DBGET integrated database retrieval system