KEGG   Gallus gallus (chicken): 396240Help
Entry
396240            CDS       T01006                                 

Gene name
CAPN1, calpain
Definition
calpain 1, (mu/I) large subunit (EC:3.4.22.52)
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
gga  Gallus gallus (chicken)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    396240 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    396240 (CAPN1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     396240 (CAPN1)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C2: calpain family
   396240 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 705 aa AA seqDB search
MMPFGGIAARLQRDRLRAEGVGEHNNAVKYLNQDYEALKQECIESGTLFRDPQFPAGPTA
LGFKELGPYSSKTRGVEWKRPSELVDDPQFIVGGATRTDICQGALGDCWLLAAIGSLTLN
EELLHRVVPHGQSFQEDYAGIFHFQIWQFGEWVDVVVDDLLPTKDGELLFVHSAECTEFW
SALLEKAYAKLNGCYESLSGGSTTEGFEDFTGGVAEMYDLKRAPRNMGHIIRKALERGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTAFKDVNYRGQQEQLIRIRNPWGQVEWTGAW
SDGSSEWDNIDPSDREELQLKMEDGEFWMSFRDFMREFSRLEICNLTPDALTKDELSRWH
TQVFEGTWRRGSTAGGCRNNPATFWINPQFKIKLLEEDDDPGDDEVACSFLVALMQKHRR
RERRVGGDMHTIGFAVYEVPEEAQGSQNVHLKKDFFLRNQSRARSETFINLREVSNQIRL
PPGEYIVVPSTFEPHKEADFILRVFTEKQSDTAELDEEISADLADEEEITEDDIEDGFKN
MFQQLAGEDMEISVFELKTILNRVIARHKDLKTDGFSLDSCRNMVNLMDKDGSARLGLVE
FQILWNKIRSWLTIFRQYDLDKSGTMSSYEMRMALESAGFKLNNKLHQVVVARYADAETG
VDFDNFVCCLVKLETMFRFFHSMDRDGTGTAVMNLAEWLLLTMCG
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgatgccctttggggggatcgctgcccggctgcagagggaccgcctgagagccgagggg
gtcggcgagcacaacaacgctgtcaagtacctcaaccaggactatgaagccctcaagcaa
gagtgcatcgagagtggcaccctcttcagggacccccagttcccagctggccccactgcc
ctcggcttcaaggagctggggccatactccagcaagacacggggcgtggagtggaagcgt
ccatcggaattagtggatgaccctcagttcatcgttggtggtgcaacccggacagatatc
tgccaaggagctctgggtgactgctggctgctggctgccatcggctccctcactctcaac
gaggaactcctgcaccgtgtggtgccccacgggcagagcttccaggaggactacgctggc
atcttccacttccagatctggcagtttggtgaatgggtggatgtggtggtggacgacctg
ctgcccaccaaggacggggagctcctgtttgtgcattcagcagagtgcacagagttctgg
agtgctctgctggagaaggcttacgccaagctgaacggctgctacgagtcgctctcaggg
ggcagcaccactgagggctttgaggatttcaccggcggcgtagcggagatgtatgacctc
aagcgggcaccgcgcaacatgggccacatcatccgcaaggcactggagagggggtccctg
ctgggctgctccatcgacatcacaagtgcctttgatatggaagcagtgaccttcaagaag
ctggtgaaaggccatgcctattctgtcaccgccttcaaagatgtgaactaccggggtcag
caggaacagctcatccgtatcagaaacccctggggtcaggtggagtggactggagcctgg
agcgatggttcttccgagtgggacaacattgaccccagcgacagagaagagctgcaactg
aagatggaggatggagagttttggatgtctttccgggacttcatgagggagttctccagg
ctggagatctgcaacctaacccccgatgccctcaccaaagatgagctcagcaggtggcac
acacaggtgttcgagggcacatggcgccgagggagcactgctgggggctgcaggaacaac
ccagccacattctggatcaatccccagtttaagatcaagctgctggaagaggatgatgac
cctggggatgacgaggtggcttgcagcttcttggtggccctgatgcagaagcaccgtagg
agggagcggcgagtagggggcgacatgcataccatcggcttcgctgtctacgaggttcct
gaggaggcccagggaagccagaatgtgcacttgaagaaggacttcttcctgcgaaaccag
tcgcgggcacgctctgagaccttcatcaacttgagggaagtgagcaaccagatccggctg
ccccctggcgagtacatcgttgtgccctccacctttgagccacacaaggaggccgacttc
atactgcgggtcttcaccgagaagcagtcagacacagcggagctggatgaggagatctcg
gcagacctggcagatgaggaagaaataaccgaggacgacattgaggatggtttcaagaac
atgttccagcagctggcaggggaggacatggaaatcagcgtcttcgagctcaagacgatt
ctgaacagagtgatcgccagacacaaagatctgaagacggatggcttcagtctggactcc
tgccgcaacatggtcaacctgatggataaagatggcagtgcccgcctggggctggtggag
ttccagatcctatggaacaagatccgcagctggctgacaatcttccgccagtatgacctg
gataaatcaggcaccatgagctcatacgagatgcgcatggctctagagtcagctggtttc
aagctgaataacaagctgcatcaggtggtggttgcccgttacgcagatgctgagacgggc
gtggacttcgacaactttgtctgctgcctggtgaagctggagacaatgttcaggttcttc
cacagcatggatcgtgatggcactggaaccgctgtcatgaatctcgctgagtggctgctg
ctgacaatgtgcggctag

DBGET integrated database retrieval system