KEGG   Gallus gallus (chicken): 396240Help
Entry
396240            CDS       T01006                                 

Gene name
CAPN11, CANP, mu/m-CAPN, mu/mCAPN
Definition
(RefSeq) calpain 11
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
gga  Gallus gallus (chicken)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    396240 (CAPN11)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    396240 (CAPN11)
   04217 Necroptosis
    396240 (CAPN11)
   04218 Cellular senescence
    396240 (CAPN11)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     396240 (CAPN11)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C2: calpain family
   396240 (CAPN11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 705 aa AA seqDB search
MMPFGGIAARLQRDRLRAEGVGEHNNAVKYLNQDYEALKQECIESGTLFRDPQFPAGPTA
LGFKELGPYSSKTRGVEWKRPSELVDDPQFIVGGATRTDICQGALGDCWLLAAIGSLTLN
EELLHRVVPHGQSFQEDYAGIFHFQIWQFGEWVDVVVDDLLPTKDGELLFVHSAECTEFW
SALLEKAYAKLNGCYESLSGGSTTEGFEDFTGGVAEMYDLKRAPRNMGHIIRKALERGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTAFKDVNYRGQQEQLIRIRNPWGQVEWTGAW
SDGSSEWDNIDPSDREELQLKMEDGEFWMSFRDFMREFSRLEICNLTPDALTKDELSRWH
TQVFEGTWRRGSTAGGCRNNPATFWINPQFKIKLLEEDDDPGDDEVACSFLVALMQKHRR
RERRVGGDMHTIGFAVYEVPEEAQGSQNVHLKKDFFLRNQSRARSETFINLREVSNQIRL
PPGEYIVVPSTFEPHKEADFILRVFTEKQSDTAELDEEISADLADEEEITEDDIEDGFKN
MFQQLAGEDMEISVFELKTILNRVIARHKDLKTDGFSLDSCRNMVNLMDKDGSARLGLVE
FQILWNKIRSWLTIFRQYDLDKSGTMSSYEMRMALESAGFKLNNKLHQVVVARYADAETG
VDFDNFVCCLVKLETMFRFFHSMDRDGTGTAVMNLAEWLLLTMCG
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgatgccctttggggggatcgctgcccggctgcagagggaccgcctgagagccgagggg
gtcggcgagcacaacaacgctgtcaagtacctcaaccaggactatgaagccctcaagcaa
gagtgcatcgagagtggcaccctcttcagggacccccagttcccagctggccccactgcc
ctcggcttcaaggagctggggccatactccagcaagacacggggcgtggagtggaagcgt
ccatcggaattagtggatgaccctcagttcatcgttggtggtgcaacccggacagatatc
tgccaaggagctctgggtgactgctggctgctggctgccatcggctccctcactctcaac
gaggaactcctgcaccgtgtggtgccccacgggcagagcttccaggaggactacgctggc
atcttccacttccagatctggcagtttggtgaatgggtggatgtggtggtggacgacctg
ctgcccaccaaggacggggagctcctgtttgtgcattcagcagagtgcacagagttctgg
agtgctctgctggagaaggcttacgccaagctgaacggctgctacgagtcgctctcaggg
ggcagcaccactgagggctttgaggatttcaccggcggcgtagcggagatgtatgacctc
aagcgggcaccgcgcaacatgggccacatcatccgcaaggcactggagagggggtccctg
ctgggctgctccatcgacatcacaagtgcctttgatatggaagcagtgaccttcaagaag
ctggtgaaaggccatgcctattctgtcaccgccttcaaagatgtgaactaccggggtcag
caggaacagctcatccgtatcagaaacccctggggtcaggtggagtggactggagcctgg
agcgatggttcttccgagtgggacaacattgaccccagcgacagagaagagctgcaactg
aagatggaggatggagagttttggatgtctttccgggacttcatgagggagttctccagg
ctggagatctgcaacctaacccccgatgccctcaccaaagatgagctcagcaggtggcac
acacaggtgttcgagggcacatggcgccgagggagcactgctgggggctgcaggaacaac
ccagccacattctggatcaatccccagtttaagatcaagctgctggaagaggatgatgac
cctggggatgacgaggtggcttgcagcttcttggtggccctgatgcagaagcaccgtagg
agggagcggcgagtagggggcgacatgcataccatcggcttcgctgtctacgaggttcct
gaggaggcccagggaagccagaatgtgcacttgaagaaggacttcttcctgcgaaaccag
tcgcgggcacgctctgagaccttcatcaacttgagggaagtgagcaaccagatccggctg
ccccctggcgagtacatcgttgtgccctccacctttgagccacacaaggaggccgacttc
atactgcgggtcttcaccgagaagcagtcagacacagcggagctggatgaggagatctcg
gcagacctggcagatgaggaagaaataaccgaggacgacattgaggatggtttcaagaac
atgttccagcagctggcaggggaggacatggaaatcagcgtcttcgagctcaagacgatt
ctgaacagagtgatcgccagacacaaagatctgaagacggatggcttcagtctggactcc
tgccgcaacatggtcaacctgatggataaagatggcagtgcccgcctggggctggtggag
ttccagatcctatggaacaagatccgcagctggctgacaatcttccgccagtatgacctg
gataaatcaggcaccatgagctcatacgagatgcgcatggctctagagtcagctggtttc
aagctgaataacaagctgcatcaggtggtggttgcccgttacgcagatgctgagacgggc
gtggacttcgacaactttgtctgctgcctggtgaagctggagacaatgttcaggttcttc
cacagcatggatcgtgatggcactggaaccgctgtcatgaatctcgctgagtggctgctg
ctgacaatgtgcggctag

DBGET integrated database retrieval system