KEGG   Gallus gallus (chicken): 396266Help
Entry
396266            CDS       T01006                                 

Gene name
RARB, RARBETA
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
gga  Gallus gallus (chicken)
Brite
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    396266 (RARB)
Nuclear receptors [BR:gga03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   396266 (RARB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
2
AA seq 455 aa AA seqDB search
MTTSSRTCPVPAVNGHMTHYPAAPYPLLFPPVIGGLSLPSLHGLQSHPPTSGCSTPSPAT
VETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPTKQESTENYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPMKVDKLQEPLLEALK
IYIRKRRPNKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPTSNGNTAEHSPSISPSSVDNSSVSQSPMVQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccagcagccgcacatgtccagtgccggcagtgaatggacatatgactcactac
ccagcagctccatacccgttactttttcctccagtcatcggtgggctgtcgctgccttcc
cttcatggactccagagtcacccaccaacgagcggatgcagcaccccatcacctgcaaca
gttgaaactcagagcaccagttctgaggaacttgttccaagccctccttcaccacttcca
cccccgcgtgtttacaagccctgttttgtctgtcaagacaaatcatctggatatcactat
ggtgtcagtgcttgtgagggatgtaagggctttttccgcaggagtatccagaagaacatg
gtttacacatgtcatagagataagaactgtgttatcaataaagttaccagaaatcgctgc
cagtactgcagactacagaagtgctttgaagtgggaatgtccaaagaatctgtcagaaat
gataggaacaaaaagaagaaggaacctacaaagcaggagtccacagaaaactatgaaatg
acagcagagctggatgatctcactgagaagatccgaaaagctcaccaggaaaccttcccc
tcgctctgccagctgggaaagtacactacaaactcgagtgcagaccatcgggttcgactg
gaccttgggctctgggacaaattcagtgaacttgcaacaaagtgcattattaaaatagtg
gaatttgcaaaacgattgccaggctttacaagcttgaccattgcagaccagataactcta
cttaaagcagcctgcctggacatactgatcctcagaatttgcacaagatacacaccagaa
caagacaccatgacattttcagatggccttaccctgaaccgaactcagatgcacaatgct
ggatttggccccctgaccgacctcgtgttcacctttgccaaccagctcctgcctttggaa
atggatgacacagaaaccggtctccttagtgccatctgcttgatctgtggagatcgccag
gaccttgaagaaccaatgaaagtggataagcttcaggaaccgttgcttgaagcgctgaaa
atctatatccgaaagagacgacccaacaagcctcacatgtttccaaagatcttaatgaaa
atcacagatcttcgtagcatcagtgcaaaaggtgcagaacgtgtcattacgttgaaaatg
gaaattcctggatccatgccacctcttattcaagaaatgttggagaactctgaaggacac
gaaccactgacaccaacctcaaatggaaatactgcagaacacagtccgagtatctcaccg
agctcagtggataacagcagtgtcagtcaatcccctatggtgcaataa

DBGET integrated database retrieval system