KEGG   Gallus gallus (chicken): 396287Help
Entry
396287            CDS       T01006                                 

Gene name
HMOX1, HO-1
Definition
heme oxygenase (decycling) 1 (EC:1.14.99.3)
Orthology
K00510  
heme oxygenase [EC:1.14.99.3]
Organism
gga  Gallus gallus (chicken)
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    396287 (HMOX1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.3  heme oxygenase (biliverdin-producing)
     396287 (HMOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 296 aa AA seqDB search
METSQPHNAESMSQDLSELLKEATKEVHEQAENTPFMKNFQKGQVSLHEFKLVTASLYFI
YSALEEEIERNKDNPVYAPVYFPMELHRKAALEKDLEYFYGSNWRAEIPCPEATQKYVER
LHVVGKKHPELLVAHAYTRYLGDLSGGQVLKKIAQKALQLPSTGEGLAFFTFDGVSNATK
FKQLYRSRMNALEMDHATKKRVLEEAKKAFLLNIQVFEALQKLVSKSQENGHAVQPKAEL
RTRSVNKSHENSPAAGKESERTSRMQADMLTTSPLVRWLLALGFIATTVAVGLFAM
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttcgcagccacacaacgctgaaagcatgtcccaggacctgtcggagctcctg
aaggaagccaccaaggaggtgcacgagcaggcggagaacacacccttcatgaagaacttc
cagaagggacaggtgtccctccacgagttcaagctggtcacggcgtccctgtacttcatc
tactctgctctggaggaagagatcgaacgtaacaaggacaaccctgtctatgctcctgtt
tattttccgatggagctgcaccggaaagctgccctggagaaagacttggagtacttctat
ggcagcaactggagggcagagatcccatgtcctgaggctactcagaaatacgttgagagg
ctccacgtcgttggcaagaagcatccagagctgttggtggcccatgcctacacccgctat
ttgggagacctgtctggggggcaggtgctgaagaaaatcgcccaaaaggccctccagctg
cccagcactggagaagggttggctttcttcaccttcgatggagtctccaacgccaccaag
ttcaaacagctctatcggtcccgaatgaatgcccttgagatggatcatgctactaagaaa
agagtcttggaggaagccaagaaagcattcctgctaaatatacaggtgtttgaggcgctg
cagaagctggtgtccaagagccaggagaacggtcatgctgtacagccaaaggcagagctt
cgcacaaggagtgttaacaaatcgcatgaaaacagtccagcagctgggaaggagagtgag
aggacaagcaggatgcaggcagacatgctgaccacctctcccctggtgcggtggctcctg
gcgctcggcttcatcgccaccacagtcgccgtgggcttatttgccatgtga

DBGET integrated database retrieval system