KEGG   Gallus gallus (chicken): 396287Help
Entry
396287            CDS       T01006                                 

Gene name
HMOX1, HO-1
Definition
(RefSeq) heme oxygenase (decycling) 1 (EC:1.14.99.3)
  KO
K00510  
heme oxygenase (biliverdin-producing) [EC:1.14.14.18]
Organism
gga  Gallus gallus (chicken)
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    396287 (HMOX1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     396287 (HMOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 296 aa AA seqDB search
METSQPHNAESMSQDLSELLKEATKEVHEQAENTPFMKNFQKGQVSLHEFKLVTASLYFI
YSALEEEIERNKDNPVYAPVYFPMELHRKAALEKDLEYFYGSNWRAEIPCPEATQKYVER
LHVVGKKHPELLVAHAYTRYLGDLSGGQVLKKIAQKALQLPSTGEGLAFFTFDGVSNATK
FKQLYRSRMNALEMDHATKKRVLEEAKKAFLLNIQVFEALQKLVSKSQENGHAVQPKAEL
RTRSVNKSHENSPAAGKESERTSRMQADMLTTSPLVRWLLALGFIATTVAVGLFAM
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttcgcagccacacaacgctgaaagcatgtcccaggacctgtcggagctcctg
aaggaagccaccaaggaggtgcacgagcaggcggagaacacacccttcatgaagaacttc
cagaagggacaggtgtccctccacgagttcaagctggtcacggcgtccctgtacttcatc
tactctgctctggaggaagagatcgaacgtaacaaggacaaccctgtctatgctcctgtt
tattttccgatggagctgcaccggaaagctgccctggagaaagacttggagtacttctat
ggcagcaactggagggcagagatcccatgtcctgaggctactcagaaatacgttgagagg
ctccacgtcgttggcaagaagcatccagagctgttggtggcccatgcctacacccgctat
ttgggagacctgtctggggggcaggtgctgaagaaaatcgcccaaaaggccctccagctg
cccagcactggagaagggttggctttcttcaccttcgatggagtctccaacgccaccaag
ttcaaacagctctatcggtcccgaatgaatgcccttgagatggatcatgctactaagaaa
agagtcttggaggaagccaagaaagcattcctgctaaatatacaggtgtttgaggcgctg
cagaagctggtgtccaagagccaggagaacggtcatgctgtacagccaaaggcagagctt
cgcacaaggagtgttaacaaatcgcatgaaaacagtccagcagctgggaaggagagtgag
aggacaagcaggatgcaggcagacatgctgaccacctctcccctggtgcggtggctcctg
gcgctcggcttcatcgccaccacagtcgccgtgggcttatttgccatgtga

DBGET integrated database retrieval system