KEGG   Gallus gallus (chicken): 396306Help
Entry
396306            CDS       T01006                                 

Gene name
THBS4
Definition
thrombospondin 4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
gga  Gallus gallus (chicken)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    396306 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    396306 (THBS4)
  Cellular commiunity
   04510 Focal adhesion
    396306 (THBS4)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   396306 (THBS4)
  Exosomal proteins of colorectal cancer cells
   396306 (THBS4)
  Exosomal proteins of bladder cancer cells
   396306 (THBS4)
Heparan sulfate/heparin binding proteins [BR:gga00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  396306 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
Z
AA seq 954 aa AA seqDB search
MGCERGAALLLLPLALQLCPGRAAPPAPRVIDLLPYANKRVVTSFLQQALGDPTLNEVFL
LSVFKLQPKSTTTIFDLYSPADDRQYFEFTVMGRMNKVVLRYLKNDGRLNSVIFSNVHLA
DGKPHAVILWLSGLQQELCTIELYLDCLQVGAIQDLPKAFSTLLERSAAVELRTFLKKPE
DTLDELKLVTGGTLAQARDLQDCFLQQIESAPQYTGDFNRQLMNQMVQMNQILGEVKDLL
KQQVKETTFLRNTIAECQACGLGTANFPTPLPRHTKPKCEASSCFRGVRCMETAEGIQCG
PCPEGLTGNGVTCSDVDECRYSPCFPGVRCVNTAPGFRCETCPPGYTGQTLQGVGLSYAK
NNKQVCLDIDECQNGGHGVCVPNSQCINTLGSYRCGQCKSGYTGDQIRGCQAERSCRSRA
LNPCSVHARCIEERRGEVTCICGIGWAGDGYICGKDIDIDGYPNEELSCPSESCRKDNCK
FVPNSGQEDADDDGIGDACDEDADGDGIPNEQDNCVLTPNVNQRNSDEDIFGDACDNCRS
VLNNDQRDTDGDGKGDACDDDMDGDGIKNLLDNCQRIPNQDQEDKDNDGVGDACDSCPTV
SNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTIINSSQLDTDKDGLGDECDEDDD
NDGIPDLLPPGPDNCRLVPNPGQEDDNGDGVGDVCESDFDQDTVIDRIDVCPENAEITLT
DFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVN
TVTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEH
LRNSLWHTGDTSDQVRLLWKDPRNVGWKDKVSYRWFLQHRPQIGYIRARFYEGSDLVADS
GVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNGNVSFFLFFSFFFFFLLMFSK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcgagcgcggcgccgccctgctgctgctgccgcttgccctgcaactctgcccg
ggccgtgccgcgccgcccgcgcctcgagttattgaccttcttccatatgccaacaagaga
gtggtaacaagcttcctgcaacaagcacttggggatcctacgctgaatgaagtgttcttg
ctttcagtgttcaaactgcagccaaagagcacaaccaccatatttgacctatattcacca
gctgatgacaggcagtattttgagtttacagtaatgggacggatgaataaagtggtgctt
cgctatctgaagaatgatgggagattgaactcggtgatttttagcaatgtacacctggct
gatgggaaaccccatgctgtcatcttgtggctgagtggcctgcagcaggaattgtgtaca
atagagttgtatctggactgtctgcaagtaggtgccattcaggacctgccaaaagcattt
tcaactctgttggagagatcggcagcagtagagttacgcaccttcctgaagaaaccagag
gatacactggatgagctgaagctggtaactggaggaacacttgcccaggcaagagacctg
caagactgttttcttcaacagattgaatctgctcctcagtacactggtgattttaatagg
cagctgatgaatcagatggtgcaaatgaaccagatactgggagaggtgaaagaccttctc
aaacaacaggtcaaggaaacaacttttttgagaaataccatagctgagtgtcaagcatgt
ggtttgggaactgcgaattttccaactccacttcctaggcataccaaacccaagtgtgaa
gcaagttcctgcttcaggggtgtcaggtgcatggagacagctgaaggaattcagtgtggc
ccgtgccctgagggactcacagggaatggagtgacatgctctgatgttgatgagtgtcgt
tacagcccctgcttccctggagtgcgttgtgtcaatactgctccaggtttccgttgtgag
acctgtcccccaggatatacaggacaaactttgcaaggagtaggactcagctatgccaag
aacaataagcaggtctgcttagacattgatgaatgtcagaatggtgggcatggagtctgt
gttccaaattctcaatgtataaacactttgggctcttatcgctgtggccagtgcaaatca
ggatacacaggcgaccaaatcagggggtgccaggctgagagaagctgcagaagtcgagcc
ctcaatccatgcagtgtccatgcccggtgtattgaggaaaggcgaggagaagtgacatgt
atttgtggcattggctgggctggtgatggttatatttgtggaaaagatattgacattgat
ggctaccctaatgaagagctctcttgcccttctgaaagctgcagaaaggacaattgtaag
tttgtcccaaactctggacaagaagatgctgatgatgatgggattggagatgcctgtgat
gaagatgcagatggagatggcattcccaatgagcaggataactgtgtcttgactcctaac
gttaaccagagaaatagtgatgaagatatctttggagatgcctgtgacaactgccgcagt
gtcctgaataatgaccaaagggacacagatggtgatgggaaaggagatgcttgtgatgat
gacatggatggagatggtattaagaaccttttagataattgtcagaggatccccaaccaa
gaccaggaggacaaggataacgatggtgttggtgatgcctgtgacagctgtcctacagtc
agcaatccaaatcagtcagatgttgacaatgacctggttggagattcttgtgataccaat
caggacagtgatggcgatgggcaccaggatagcacagacaactgccccaccattatcaac
agctcccagctggacacagataaggacgggctgggtgacgagtgcgatgaggatgatgat
aatgatggcattcctgatctcttgccaccaggccctgacaactgtaggctagtccccaac
ccagggcaggaagatgataatggtgatggagttggggatgtctgtgagtctgattttgac
caggatacagtaattgatcggatcgatgtctgccctgagaacgcagagatcaccctgacg
gacttcagggcctatcagactgtggtgctggacccagagggagatgcacagattgacccc
aactgggtggttctaaaccagggcatggaaattgtgcagactatgaacagtgatcctggc
cttgctgttggttacactgcttttaatggtgttgacttcgagggcacttttcatgtgaac
acggtgacagatgacgactacgctggttttatttttggctatcaagacagctctagtttt
tatgtggtaatgtggaaacagactgaacagacatactggcaagcaactcccttcagagct
gttgcagagcctggtattcagctgaaggctgtgaaatcaaagacaggccctggtgagcac
ctacgcaactccctctggcacacgggggacaccagcgaccaggtcaggctgctgtggaag
gaccctcgaaatgtggggtggaaagacaaagtctcctaccgctggttcttgcagcacaga
ccccagattgggtatatcagggcaagattttatgaaggctctgacctggtagcggactct
ggtgtaactatagacaccacaatgcgtggaggacggcttggagttttctgcttttctcag
gaaaacattatctggtccaacctgaaatatcgctgtaacggtaatgtttctttttttctt
ttcttttcttttttttttttttttttgctaatgtttagcaagtga

DBGET integrated database retrieval system