KEGG   Gallus gallus (chicken): 396306Help
Entry
396306            CDS       T01006                                 

Gene name
THBS4, thrombospondin-4
Definition
(RefSeq) thrombospondin 4
  KO
K04659  thrombospondin 2/3/4/5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04145  Phagosome
gga04510  Focal adhesion
gga04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    396306 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    396306 (THBS4)
  Cellular community - eukaryotes
   04510 Focal adhesion
    396306 (THBS4)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Phagocytosis
   Opsonins
    396306 (THBS4)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   396306 (THBS4)
  Exosomal proteins of colorectal cancer cells
   396306 (THBS4)
  Exosomal proteins of bladder cancer cells
   396306 (THBS4)
Cell adhesion molecules and their ligands [BR:gga04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     396306 (THBS4)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     396306 (THBS4)
   VNR
     396306 (THBS4)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   396306 (THBS4)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   396306 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA EGF cEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 396306
NCBI-ProteinID: NP_001308478
CGNC: 49745
Ensembl: ENSGALG00000014804
UniProt: F1NBP0
Position
Z
AA seq 953 aa AA seqDB search
MGCERGAALLLLPLALQLCPGRAAPPAPRVIDLLPYANKRVVTSFLQQALGDPTLNEVFL
LSVFKLQPKSTTTIFDLYSPADDRQYFEFTVMGRMNKVVLRYLKNDGRLNSVIFSNVHLA
DGKPHAVILWLSGLQQELCTIELYLDCLQVGAIQDLPKAFSTLLERSAAVELRTFLKKPE
DTLDELKLVTGGTLAQARDLQDCFLQQIESAPQYTGDFNRQLMNQMVQMNQILGEVKDLL
KQQVKETTFLRNTIAECQACGLGTANFPTPLPRHTKPKCEASSCFRGVRCMETAEGIQCG
PCPEGLTGNGVTCSDVDECRYSPCFPGVRCVNTAPGFRCETCPPGYTGQTLQGVGLSYAK
NNKQVCLDIDECQNGGHGVCVPNSQCINTLGSYRCGQCKSGYTGDQIRGCQAERSCRSRA
LNPCSVHARCIEERRGEVTCICGIGWAGDGYICGKDIDIDGYPNEELSCPSESCRKDNCK
FVPNSGQEDADDDGIGDACDEDADGDGIPNEQDNCVLTPNVNQRNSDEDIFGDACDNCRS
VLNNDQRDTDGDGKGDACDDDMDGDGIKNLLDNCQRIPNQDQEDKDNDGVGDACDSCPTV
SNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTIINSSQLDTDKDGLGDECDEDDD
NDGIPDLLPPGPDNCRLVPNPGQEDDNGDGVGDVCESDFDQDTVIDRIDVCPENAEITLT
DFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVN
TVTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEH
LRNSLWHTGDTSDQVRLLWKDPRNVGWKDKVSYRWFLQHRPQIGYIRARFYEGSDLVADS
GVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQAQQFGVGDI
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcgagcgcggcgccgccctgctgctgctgccgcttgccctgcaactctgcccg
ggccgtgccgcgccgcccgcgcctcgagttattgaccttcttccatatgccaacaagaga
gtggtaacaagcttcctgcaacaagcacttggggatcctacgctgaatgaagtgttcttg
ctttcagtgttcaaactgcagccaaagagcacaaccaccatatttgacctatattcacca
gctgatgacaggcagtattttgagtttacagtaatgggacggatgaataaagtggtgctt
cgctatctgaagaatgatgggagattgaactcggtgatttttagcaatgtacacctggct
gatgggaaaccccatgctgtcatcttgtggctgagtggcctgcagcaggaattgtgtaca
atagagttgtatctggactgtctgcaagtaggtgccattcaggacctgccaaaagcattt
tcaactctgttggagagatcggcagcagtagagttacgcaccttcctgaagaaaccagag
gatacactggatgagctgaagctggtaactggaggaacacttgcccaggcaagagacctg
caagactgttttcttcaacagattgaatctgctcctcagtacactggtgattttaatagg
cagctgatgaatcagatggtgcaaatgaaccagatactgggagaggtgaaagaccttctc
aaacaacaggtcaaggaaacaacttttttgagaaataccatagctgagtgtcaagcatgt
ggtttgggaactgcgaattttccaactccgcttcctaggcataccaaacccaagtgtgaa
gcaagttcctgcttcaggggtgtcaggtgcatggagacagctgaaggaattcagtgtggc
ccgtgccctgagggactcacagggaatggagtgacatgctctgatgttgatgagtgtcgt
tacagcccctgcttccctggagtgcgttgtgtcaatactgctccaggtttccgttgtgag
acctgtcccccaggatatacaggacaaactttgcaaggagtaggactcagctatgccaag
aacaataagcaggtctgcttagacattgatgaatgtcagaatggtgggcatggagtctgt
gttccaaattctcaatgtataaacactttgggctcttatcgctgtggccagtgcaaatca
ggatacacaggcgaccaaatcagggggtgccaggctgagagaagctgcagaagtcgagcc
ctcaatccatgcagtgtccatgcccggtgtattgaggaaaggcgaggagaagtgacatgt
atttgtggcattggctgggctggtgatggttatatttgtggaaaagatattgacattgat
ggctaccctaatgaagagctctcttgcccttctgaaagctgcagaaaggacaattgtaag
tttgtcccaaactctggacaagaagatgctgatgatgatgggattggagatgcctgtgat
gaagatgcagatggagatggcattcccaatgagcaggataactgtgtcttgactcctaac
gttaaccagagaaatagtgatgaagatatctttggagatgcctgtgacaactgccgcagt
gtcctgaataatgaccaaagggacacagatggtgatgggaaaggagatgcttgtgatgat
gacatggatggagatggtattaagaaccttttagataattgtcagaggatccccaaccaa
gaccaggaggacaaggataacgatggtgttggtgatgcctgtgacagctgtcctacagtc
agcaatccaaatcagtcagatgttgacaatgacctggttggagattcttgtgataccaat
caggacagtgatggcgatgggcaccaggatagcacagacaactgccccaccattatcaac
agctcccagctggacacagataaggacgggctgggtgacgagtgcgatgaggatgatgat
aatgatggcattcctgatctcttgccaccaggccctgacaactgtaggctagtccccaac
ccagggcaggaagatgataatggtgatggagttggggatgtctgtgagtctgattttgac
caggatacagtaattgatcggatcgatgtctgccctgagaacgcagagatcaccctgacg
gacttcagggcctatcagactgtggtgctggacccagagggagatgcacagattgacccc
aactgggtggttctaaaccagggcatggaaattgtgcagactatgaacagtgatcctggc
cttgctgttggttacactgcttttaatggtgttgacttcgagggcacttttcatgtgaac
acggtgacagatgacgactacgctggttttatttttggctatcaagacagctctagtttt
tatgtggtaatgtggaaacagactgaacagacatactggcaagcaactcccttcagagct
gttgcagagcctggtattcagctgaaggctgtgaaatcaaagacaggccctggtgagcac
ctacgcaactccctctggcacacgggggacaccagcgaccaggtcaggctgctgtggaag
gaccctcgaaatgtggggtggaaagacaaagtctcctaccgctggttcttgcagcacaga
ccccagattgggtatatcagggcaagattttatgaaggctctgacctggtagcggactct
ggtgtaactatagacaccacaatgcgtggaggacggcttggagttttctgcttttctcag
gaaaacattatctggtccaacctgaaatatcgctgtaacgacaccatcccagaggacttt
caagaatttcaagctcagcaatttggcgttggggatatttaa

DBGET integrated database retrieval system