KEGG   Gallus gallus (chicken): 396366Help
Entry
396366            CDS       T01006                                 

Gene name
TPM1, alpha-fTM
Definition
tropomyosin 1 (alpha)
Orthology
K10373  
tropomyosin 1
Organism
gga  Gallus gallus (chicken)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    396366 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    396366 (TPM1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   396366 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEERSKQLEDELVALQKKLKGTEDELDKY
SESLKDAQEKLELADKKATDAESEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAQKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAE
ERAELSESQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDKYEEEIKVLTDKLKEAETRAE
FAERSVTKLEKSIDDLEEKVAHAKEENLNMHQMLDQTLLELNNM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaaaaagatgcagatgctgaaactggacaaggagaatgccttggac
agagccgagcaagccgaagcggacaagaaggcagcggaggagaggagcaagcagctggag
gacgagctggtggctctgcaaaagaagctgaagggcactgaggatgagctggacaaatac
tccgagtcccttaaagatgcacaggaaaagttggaactggctgacaaaaaggccacagat
gctgagagtgaagtagcttccctgaacagacgcatccaactggttgaggaagagttggat
cgggctcaggagcgcttggctactgccctgcagaagctggaggaggctgagaaggctgca
gatgagagtgaaagaggaatgaaggtcattgaaaatagagcccagaaggatgaagagaag
atggaaatccaagagatccagcttaaagaagctaagcacattgctgaagaggctgaccgc
aagtatgaagaggtggctcgtaagctcgtgatcattgagggtgacctggagcgggctgag
gagcgtgctgaactatcagaaagccaagtccgacagctggaagaacagttaagaataatg
gatcaaaccttgaaagcattaatggctgcagaggataagtactcgcagaaagaagacaaa
tatgaagaggagattaaagttctaactgacaaactgaaggaggctgagacccgtgctgaa
tttgctgagaggtcagtaaccaagctggagaagagcattgatgatctagaagagaaagtg
gcgcatgccaaagaagaaaaccttaatatgcatcagatgctggatcaaactttactggag
ttaaacaacatgtga

DBGET integrated database retrieval system