KEGG   Gallus gallus (chicken): 396366Help
Entry
396366            CDS       T01006                                 

Gene name
TPM1, alpha-fTM
Definition
(RefSeq) tropomyosin 1 (alpha)
  KO
K10373  tropomyosin 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    396366 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    396366 (TPM1)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     396366 (TPM1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   396366 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II TMF_DNA_bd IncA DUF745 Fib_alpha DUF1664 XhlA CENP-F_leu_zip ADIP AAA_13 HrpB7 T3SSipB
Motif
Other DBs
NCBI-GeneID: 396366
NCBI-ProteinID: NP_990732
CGNC: 49772
Ensembl: ENSGALG00000003521
UniProt: P04268
Structure
PDB: 

Jmol
Position
10
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEERSKQLEDELVALQKKLKGTEDELDKY
SESLKDAQEKLELADKKATDAESEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAQKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAE
ERAELSESQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDKYEEEIKVLTDKLKEAETRAE
FAERSVTKLEKSIDDLEEKVAHAKEENLNMHQMLDQTLLELNNM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaaaaagatgcagatgctgaaactggacaaggagaatgccttggac
agagccgagcaagccgaagcggacaagaaggcagcggaggagaggagcaagcagctggag
gacgagctggtggctctgcaaaagaagctgaagggcactgaggatgagctggacaaatac
tccgagtcccttaaagatgcacaggaaaagttggaactggctgacaaaaaggccacagat
gctgagagtgaagtagcttccctgaacagacgcatccaactggttgaggaagagttggat
cgggctcaggagcgcttggctactgccctgcagaagctggaggaggctgagaaggctgca
gatgagagtgaaagaggaatgaaggtcattgaaaatagagcccagaaggatgaagagaag
atggaaatccaagagatccagcttaaagaagctaagcacattgctgaagaggctgaccgc
aagtatgaagaggtggctcgtaagctcgtgatcattgagggtgacctggagcgggctgag
gagcgtgctgaactatcagaaagccaagtccgacagctggaagaacagttaagaataatg
gatcaaaccttgaaagcattaatggctgcagaggataagtactcgcagaaagaagacaaa
tatgaagaggagattaaagttctaactgacaaactgaaggaggctgagacccgtgctgaa
tttgctgagaggtcagtaaccaagctggagaagagcattgatgatctagaagagaaagtg
gcgcatgccaaagaagaaaaccttaatatgcatcagatgctggatcaaactttactggag
ttaaacaacatgtga

DBGET integrated database retrieval system