KEGG   Gallus gallus (chicken): 396376Help
Entry
396376            CDS       T01006                                 

Gene name
GSBP9
Definition
glycosylation site-binding protein (EC:2.4.99.18)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:gga04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
AA seq 508 aa AA seqDB search
MLRALCALAWRVARVGADAEEQDNVLVAKKSNFLEPLAAHSYLAVEFYAPLCGHCKALAP
DYAKAGGKLKAEGSEIKAAKVEATEESDLAQQYGVRAYPTIKFFKNGDTASPKEYTAGRE
ADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEITVIIGFFKDPGSDSARQFLLAADAVD
DVPFGINSNSDVYSKYQMDKDAVVLFKKFAEGRNNFEGEITKEKLLDFIKHNNLPLVIEF
TEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNLKKAADGFKGKILFVFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLDEELTKYKPETEELTAEKLTQFCHHFLEGKIKPHLMSNEP
LPEDWDKQPVKVLVGKNYEEVAFDEKKNVFIEFYAPWCGHCKQLAPMWDRLGEAYKDDEN
IVIAKMESTANEVEAIKVHSFPTLKFFPASAERTVIDYNGERTLDGYKKFLESGGQDGYG
NNDDDDLEEALESDMEEDEDQKAMKDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctacgcgctctgtgtgccctggcttggcgtgtagcccgagtcggagcagacgctgag
gagcaggacaatgtgctggtggccaagaagagcaactttctggagccgctggctgctcac
agctacctggctgtggagttctatgcaccattgtgtggccattgtaaggcactagccccc
gattacgcaaaggctggtggaaaactgaaagcggaaggctcagagataaaagccgcaaag
gtagaagccacagaagaatccgatctggcccagcaatacggtgtccgcgcctatccaacc
atcaaattctttaagaatggagacacagcctccccaaaggaatatacagctggcagggaa
gctgatgacattgtcaactggctgaaaaaacgcacaggcccagcagccacaaccctatct
gacactgcagcagctgagtccttggtggactcatcagaaataacggtcatcatcggcttc
ttcaaagacccagggtcagattccgccaggcagttcttgctggcagcagacgctgttgat
gatgtaccttttggaatcaattccaatagcgatgtgtattccaagtaccagatggacaag
gatgcggtcgtcctctttaaaaagtttgctgaaggccgcaacaattttgaaggtgagatc
accaaggagaaactgttagacttcatcaagcacaacaatctgcccttggtcatcgagttc
actgaacagacagctccaaagattttcggaggagaaatcaagacacatattctgctgttc
ctgcccaagagtgtgtctgactacgatggcaaattgagcaacttgaagaaagcggccgac
ggctttaagggcaagatcctgttcgtctttatcgatagtgaccacactgacaaccagcgc
atacttgagttcttcggcctgaagaaggaggaatgtccagctgtgcggcttattaccctg
gatgaagagctgaccaagtacaaacccgagacagaggagctgacagctgagaaactcaca
caattttgccaccatttcctggagggcaagatcaagccccacctcatgagcaatgaacca
ctgcctgaagactgggacaaacagccagtgaaagtgctagttgggaaaaactatgaggag
gttgctttcgatgagaaaaagaacgtgtttattgaattctatgctccctggtgtggtcac
tgcaagcagctagccccgatgtgggatcgtctgggagaggcatacaaggacgatgagaat
atcgtcatcgctaaaatggaatcaacagccaatgaggtggaagctattaaggtgcacagc
ttcccaacactcaagttcttcccagcaagtgcagagagaacggtcattgattacaacggt
gagcggacactagatggttataagaaattcttggagagcggtggccaggatggatatggg
aataatgacgatgacgacctagaagaagctttagagtccgatatggaagaagacgaagat
cagaaagccatgaaggatgaactgtaa

DBGET integrated database retrieval system