KEGG   Gallus gallus (chicken): 396376Help
Entry
396376            CDS       T01006                                 

Gene name
GSBP9
Definition
glycosylation site-binding protein (EC:2.4.99.18)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    396376 (GSBP9)
Enzymes [BR:gga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     396376 (GSBP9)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   396376 (GSBP9)
  Exosomal proteins of colorectal cancer cells
   396376 (GSBP9)
  Exosomal proteins of bladder cancer cells
   396376 (GSBP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
AA seq 508 aa AA seqDB search
MLRALCALAWRVARVGADAEEQDNVLVAKKSNFLEPLAAHSYLAVEFYAPLCGHCKALAP
DYAKAGGKLKAEGSEIKAAKVEATEESDLAQQYGVRAYPTIKFFKNGDTASPKEYTAGRE
ADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEITVIIGFFKDPGSDSARQFLLAADAVD
DVPFGINSNSDVYSKYQMDKDAVVLFKKFAEGRNNFEGEITKEKLLDFIKHNNLPLVIEF
TEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNLKKAADGFKGKILFVFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLDEELTKYKPETEELTAEKLTQFCHHFLEGKIKPHLMSNEP
LPEDWDKQPVKVLVGKNYEEVAFDEKKNVFIEFYAPWCGHCKQLAPMWDRLGEAYKDDEN
IVIAKMESTANEVEAIKVHSFPTLKFFPASAERTVIDYNGERTLDGYKKFLESGGQDGYG
NNDDDDLEEALESDMEEDEDQKAMKDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctacgcgctctgtgtgccctggcttggcgtgtagcccgagtcggagcagacgctgag
gagcaggacaatgtgctggtggccaagaagagcaactttctggagccgctggctgctcac
agctacctggctgtggagttctatgcaccattgtgtggccattgtaaggcactagccccc
gattacgcaaaggctggtggaaaactgaaagcggaaggctcagagataaaagccgcaaag
gtagaagccacagaagaatccgatctggcccagcaatacggtgtccgcgcctatccaacc
atcaaattctttaagaatggagacacagcctccccaaaggaatatacagctggcagggaa
gctgatgacattgtcaactggctgaaaaaacgcacaggcccagcagccacaaccctatct
gacactgcagcagctgagtccttggtggactcatcagaaataacggtcatcatcggcttc
ttcaaagacccagggtcagattccgccaggcagttcttgctggcagcagacgctgttgat
gatgtaccttttggaatcaattccaatagcgatgtgtattccaagtaccagatggacaag
gatgcggtcgtcctctttaaaaagtttgctgaaggccgcaacaattttgaaggtgagatc
accaaggagaaactgttagacttcatcaagcacaacaatctgcccttggtcatcgagttc
actgaacagacagctccaaagattttcggaggagaaatcaagacacatattctgctgttc
ctgcccaagagtgtgtctgactacgatggcaaattgagcaacttgaagaaagcggccgac
ggctttaagggcaagatcctgttcgtctttatcgatagtgaccacactgacaaccagcgc
atacttgagttcttcggcctgaagaaggaggaatgtccagctgtgcggcttattaccctg
gatgaagagctgaccaagtacaaacccgagacagaggagctgacagctgagaaactcaca
caattttgccaccatttcctggagggcaagatcaagccccacctcatgagcaatgaacca
ctgcctgaagactgggacaaacagccagtgaaagtgctagttgggaaaaactatgaggag
gttgctttcgatgagaaaaagaacgtgtttattgaattctatgctccctggtgtggtcac
tgcaagcagctagccccgatgtgggatcgtctgggagaggcatacaaggacgatgagaat
atcgtcatcgctaaaatggaatcaacagccaatgaggtggaagctattaaggtgcacagc
ttcccaacactcaagttcttcccagcaagtgcagagagaacggtcattgattacaacggt
gagcggacactagatggttataagaaattcttggagagcggtggccaggatggatatggg
aataatgacgatgacgacctagaagaagctttagagtccgatatggaagaagacgaagat
cagaaagccatgaaggatgaactgtaa

DBGET integrated database retrieval system