KEGG   Gallus gallus (chicken): 396388Help
Entry
396388            CDS       T01006                                 

Gene name
ACHE
Definition
(RefSeq) acetylcholinesterase (Yt blood group)
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Position
Un
AA seq 359 aa AA seqDB search
MAQPPAMAPLFLLLLLLLSPSPTSAHPDFAYSAPNRPEVRTTTGSVRGLLIPAGPSGSTA
AAFLGIPFAVPPLGPLRFRPPLPIPTPWTGIRDADSQPFACYQMVDTTFPGFQGSEMWNP
NREMSEDCLYLNVWTPKRRPYRAPVLVWIYGGGFYSGSVSLDVYDGRYLAAAEEAVVVSM
NYRVGSLGFLALAGHRDAPGNVGLWDQRLALQWVRDNAEAFGGDPDLITLFGESAGAASV
GFHLLSPHSKGLFRRAVLQSGSPNGPWATIGAAEGRRRAAALGRAVGCPYGNETEFLGCL
RGKEAAELLEGEGVVMPPQSVFRFAFVPVVDGDFVVDSPDVALWGDYGVKGGEGGHGVE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcacagccccccgcgatggcgcctctcttcctcctcctcctcctcctcctctccccc
tccccgacttccgcccacccggatttcgcctacagcgcccccaaccgcccggaggtccgc
accaccaccggctccgtccgcggccttttgatccccgccggcccatcgggttcgacggcc
gccgcctttttggggatcccattcgccgtcccccctttgggacccctccgtttccgtccc
cctctccccatcccgaccccatggaccggcatccgagacgccgattcgcaaccctttgcc
tgctatcagatggtagacaccaccttcccgggtttccaaggctccgagatgtggaacccc
aatagggaaatgagcgaggattgcctttacctcaacgtgtggaccccaaaaaggcgaccc
tacagagcccccgttttggtgtggatttacggggggggtttttacagcggttcggtgtct
ttggacgtttacgacgggcgctatttggccgcggctgaggaggcggtggtggtgtccatg
aattatagggtgggctctttggggtttttggccttagcgggtcatagggacgctccgggc
aatgtgggtttatgggatcaacgtttggccctgcaatgggttcgggataacgcggaggcg
ttcggaggggaccccgatttgatcactttattcggggagagcgccggggccgcctcggtg
ggttttcacctcttatcgccccatagcaaagggttgttccgtagggccgtcctacagagc
ggatcccccaacgggccgtgggccactataggggcggcggaagggaggaggagggcggcg
gctttggggagggccgtggggtgcccttatgggaacgagacggagtttttggggtgctta
agggggaaggaggcggcggagctgttggaaggggaaggggtggtgatgccgccccaaagc
gtctttaggttcgctttcgtgcccgtggtggacggggatttcgtggtcgatagccccgat
gtggcgttgtggggggattatggggtgaaggggggggagggcggtcacggggtcgag

DBGET integrated database retrieval system