KEGG   Gallus gallus (chicken): 396388Help
Entry
396388            CDS       T01006                                 

Gene name
ACHE
Definition
acetylcholinesterase (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    396388 (ACHE)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     396388 (ACHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
Un
AA seq 767 aa AA seqDB search
MAPLFLLLLLLLSPSPTSAHRFAYSAPNRPEVRTTTGSVRGLLIPAGPSGSTAAAFLGIP
FAVPPLGPLRFRPPLPIPTPWTGIRDADSQPFACYQMVDTTFPGFQGSEMWNPNREMSED
CLYLNVWTQKGDPTEPPVLVWIYGGGFTGGSVSLDVYDGRYLAAAEEAVVVSMNYRVGSL
GFLALAGHRDAPGNVGLWDQRLALQWVRDNAEAFGGDPDLITLFGESAGAASVGFHLLSP
HSKGLFRRAVLQSGSPNGPWATIGAAEGRRRAAALGRAVGCPYGNETEFLGCLRGKEAAD
VLEGEGVVMPPQSVFRFAFVPVVDGDFVVDSPDVALWGDYGVKGGEGGHGVEGGDGGYGV
KGGDGVKGGYGGGYGARGVREGDGDGGYGVKEGLREGYGVKEGYGVEGDGANAYGARVPP
RPHRDETPPDAYGAKGSADAYGAKAAPRPHRDETSPDAYGAKMPPRPHRDEASPDTYGAK
MPPRPHRDETSPDAYGAKMPPRPHRAGGEVEVLLGAVRVEGSYFLVYGVPGFGKDNESLI
SREEFLGGVRMGVPQATELAAEAVVLHYTDWLDADNPVKNREALDDIVGDHNVVCPLMAF
AQRWAQRGGKVYAYLFDHRSSTLLWPSWMGVPHGYEIEFVFGLPLEPRNNYTREEVELSR
RIMRYWGNFARTGDPNGGVGGPRWPPYTPSGQRYAHLNARPLSVGHGLRTQICAFWTRFL
PKLLNATGPPEDAEREWRLEFHRWSSYMGRWRTQFEHYSRQQPCATL
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctctcttcctcctcctcctcctcctcctctccccctccccgacttccgcccac
cgatttgcctacagcgcccccaaccgcccggaggtccgcaccaccaccggctccgtccgc
ggccttttgatccccgccggcccatcgggttcgacggccgccgcctttttggggatccca
ttcgccgtcccccctttgggacccctccgtttccgtccccctctccccatcccgacccca
tggaccggcatccgagacgccgattcgcaaccctttgcctgctatcagatggtagacacc
accttcccgggtttccaaggctccgagatgtggaaccccaatagggaaatgagcgaggat
tgcctttacctcaacgtgtggacccaaaaaggcgaccctacagagccccccgttttggtg
tggatttacggggggggttttacaggcggttcggtgtctttggacgtttacgacgggcgc
tatttggccgcggctgaggaggcggtggtggtgtccatgaattatagggtgggctctttg
gggtttttggccttagcgggtcatagggacgctccgggcaatgtgggtttatgggatcaa
cgtttggccctgcaatgggttcgggataacgcggaggcgttcggaggggaccccgatttg
atcactttattcggggagagcgccggggccgcctcggtgggttttcacctcttatcgccc
catagcaaagggttgttccgtagggccgtcctacagagcggatcccccaacgggccgtgg
gccactataggggcggcggaagggaggaggagggcggcggctttggggagggccgtgggg
tgcccttatgggaacgagacggagtttttggggtgcttaagggggaaggaggcggcggac
gtgttggaaggggaaggggtggtgatgccgccccaaagcgtctttaggttcgctttcgtg
cccgtggtggacggggatttcgtggtcgatagccccgatgtggcgttgtggggggattat
ggggtgaaggggggggagggcggtcacggggtcgaggggggggacgggggttatggggtg
aaagggggggatggggtgaaggggggttatggggggggttatggggccaggggggtgagg
gagggtgatggggatgggggttatggggtgaaggaggggctcagggagggttatggggtg
aaggagggttatggggttgagggtgatggggcgaatgcttatggggccagggtgcccccc
agaccccacagagacgagacaccgcccgatgcttatggggccaaggggtcagccgatgct
tatggggccaaggcagcccccagaccccatagggacgagacatcccccgacgcttacggg
gccaaaatgccccccagaccccacagagacgaggcgtctcccgacacttatggggccaaa
atgccccccagaccccatagggacgagacatcccccgacgcttatggggccaaaatgccc
cccagaccccatagggctggcggggaggtggaggtgcttttgggggccgtcagggtcgag
ggttcctatttcctggtctatggggtccccggcttcgggaaagataatgaaagcctcatc
agcagggaggagtttttagggggggtccgcatgggggtcccccaagcgaccgaattggcg
gctgaggccgtggtgcttcattacaccgattggttggacgccgataaccccgtgaagaac
agggaggctttggacgacatcgtgggggaccacaacgtggtttgccccctgatggccttc
gcccaacgttgggctcagaggggggggaaggtttacgcttatctgttcgaccaccgctcc
tccaccctattgtggccttcgtggatgggggtcccccacggttacgagattgagttcgtc
ttcgggctgcctctggagcccagaaataattacaccagggaggaggtggagctgagccgg
aggatcatgcgctactgggggaacttcgcccgcacgggggaccccaatgggggggtgggg
ggcccccgctggccgccctacacaccatcggggcagcgctacgcccacctgaacgcccga
cccctttctgtggggcacggcctgaggacgcagatctgcgccttctggacccgcttcctg
cccaagctgctcaacgccaccggtcccccggaggacgctgagcgcgaatggcgcctggag
ttccaccgctggagttcctacatgggccgctggaggacccaattcgagcactacagtcgg
cagcagccctgcgccaccctgtga

DBGET integrated database retrieval system