KEGG   Gallus gallus (chicken): 396435Help
Entry
396435            CDS       T01006                                 

Gene name
TPI1
Definition
triosephosphate isomerase 1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    396435 (TPI1)
   01230 Biosynthesis of amino acids
    396435 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    396435 (TPI1)
   00051 Fructose and mannose metabolism
    396435 (TPI1)
   00562 Inositol phosphate metabolism
    396435 (TPI1)
Enzymes [BR:gga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     396435 (TPI1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   396435 (TPI1)
  Exosomal proteins of bladder cancer cells
   396435 (TPI1)
  Exosomal proteins of melanoma cells
   396435 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 248 aa AA seqDB search
MAPRKFFVGGNWKMNGDKKSLGELIHTLNGAKLSADTEVVCGAPSIYLDFARQKLDAKIG
VAAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEG
LGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQQ
AQEVHEKLRGWLKSHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKPEF
VDIINAKH
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaggaagttcttcgtgggtggcaactggaagatgaacggcgacaagaagagc
ttgggcgagctcatccacacgctgaatggcgccaagctctcggccgacaccgaggtggtt
tgcggagccccttcaatctaccttgattttgcccgccagaagcttgatgcaaagattgga
gttgcagcacaaaactgttacaaggtaccgaagggtgctttcacaggagagatcagccca
gcaatgatcaaagatattggagctgcatgggtgatcctgggccactcagagcggaggcat
gtttttggagagtctgatgagttgattgggcagaaggtggctcatgctcttgctgaaggc
ctcggtgtcatcgcctgcattggggagaagctggatgagagagaagctggcataacggag
aaggtggtctttgaacagaccaaagctattgctgataacgtgaaggactggagtaaggtg
gttcttgcctatgagccagtttgggctatcggaactggtaaaactgctactccccaacag
gctcaggaggttcatgagaagctgagaggctggctcaaaagccacgtgtctgatgctgtt
gctcagtcaactaggatcatctatggaggttcagtcactggtggcaactgtaaggaactg
gcctcccagcatgatgtggatggcttccttgttggtggggcttctctcaagccagagttt
gtggatattatcaatgcaaaacattaa

DBGET integrated database retrieval system