KEGG   Gallus gallus (chicken): 396504Help
Entry
396504            CDS       T01006                                 

Gene name
ACACA, ACAC
Definition
acetyl-CoA carboxylase alpha (EC:6.4.1.2 6.3.4.14)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
gga  Gallus gallus (chicken)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gga01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gga00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gga00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:gga00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:gga04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
19
AA seq 2324 aa AA seqDB search
MEESSQPAKPLEMNPHSRFIIGSVSEDNSEDETSSLVKLDLLEEKERSLSPVSVCSDSLS
DLGLPSAQDGLANHMRPSMSGLHLVKQGRDRKKVDVQRDFTVASPAEFVTRFGGNRVIEK
VLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWNGSGLRVDWQENDLQKRILNVPQELYEKGYVKDADDGLRA
AEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEV
QILADQYGNAISLFGRDCSVQRRHQKIIEEAPASIATSVVFEHMEQCAVKLAKMVGYVSA
GTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRVMY
GVSPWGDGSIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQQNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSFRNSVSNFLHSLERGQV
LPAHTLLNTVDVELIYEGRKYVLKVTRQSPNSYVVIMNSSCVEVDVHRLSDGGLLLSYDG
SSYTTYMKEEVDRYRITIGNKTCVFEKENDPSILRSPSAGKLIQYVVEDGGHVFAGQCFA
EIEVMKMVMTLTAGESGCIHYVKRPGAVLDPGCVIAKLQLDDPSRVQQAELHTGTLPQIQ
STALRGEKLHRIFHYVLDNLVNVMNGYCLPEPYFSSKVKGWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
FFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLKVETQFQHGHYDKCVFALREENKSD
MNAVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELINILTELTQLSKTTNAKVALR
ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRMSFSSNLNH
YGMVHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMSCFCDSPPQSPTFPE
AGHASLYDEDKAAREEPIHILNVAIKTDGDVDDDGLAAMFREFTQSKKSVLIEHGIRRLT
FLVAQKREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHL
YLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNN
TNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTG
KAIPIRLFLTNESGYYLDISLYKEVTDSRTGQIMFQAYGDKQGPLHGMLINTPYVTKDLL
QSKRFQAQSLGTSYVYDIPEMFRQSLIKLWDSMNEHAFLPTPPLPSDILTYTELVLDDQG
QLVHMNRLPGGNEIGMVAWKMTLKTPEYPEGRDIIVIGNDITYRIGSFGPQEDVLFLRAS
ELARTHGIPRIYVAANSGARIGLAEEIRHMFHVAWEDPDDPYKGYKYLYLTPQDYKKVSA
LNSVHCEHVEDNGESRYKITDIIGKEDGLGIENLRGSGMIAGESSLAYESIITINLVTCR
AIGIGAYLVRLGQRTIQVENSHIILTGCGALNKVLGREVYTSNNQLGGIQIMHNNGVTHG
TVCDDFEGVYTILLWLSYMPKSVYSPVPILKVKDPIDRTIDFVPTKTPYDPRWMLAGRPN
PSQKGQWQSGFFDNGSFLEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPAN
LDSEAKIIQQAGQVWFPDSAFKTAQAINDFNREGLPLMVFANWRGFSGGMKDMYDQVLKF
GAYIVDGLREYRQPVLIYIPPQAELRGGSWAVIDPTINPRHMEMYADRESRGGILEPEGT
VEIKFRRKDLVKTMRRVDPVYMRLAERLGTPELSAADRKDLESKLKEREEFLIPIYHQVA
MQFADLHDTPGRMQEKGAITDILDWKTSRTFFYWRLRRLLLEDVVKKKIHDANPELTDGQ
IQAMLRRWFVEVEGTVKAYLWDSNKDLVEWLEKQLMEEEGVRSVVDENIKYISRDYILKQ
IRSLVQANPEVAMDSIVHMTQHISPTQRAEIVRILSTMDSPSST
NT seq 6975 nt NT seq  +upstreamnt  +downstreamnt
atggaagagtcttcccaacctgctaaacccctggagatgaaccctcactctcgctttatt
attggttccgtgtcagaggataactcagaagatgagacgagctccttggtgaaacttgac
ctgctggaggagaaagagaggtctctgtcccctgtttctgtctgctcggattccctttcg
gatttgggacttcctagtgctcaagatggtttggcaaaccatatgaggcccagcatgtct
ggtttgcacctcgtaaagcaaggccgggacaggaagaaagttgacgtgcagcgggatttc
actgtggcttctccagcagaatttgttactcgttttggagggaacagagttattgagaag
gtcctgatagccaacaatgggattgcagcagtgaaatgcatgaggtcgatccggcgctgg
tcctatgagatgttccgaaacgagcgggcaatcagatttgttgtcatggtgactcctgag
gacctgaaagcaaatgcagagtacattaaaatggcagatcactacgtgccagttccagga
ggaccaaacaacaacaactatgcaaatgtggaactcattctcgatattgcaaaacgcatt
ccagtgcaggctgtttgggctggctggggccatgcctccgagaacccaaaactaccagaa
cttctccacaaaaatgggattgctttcatgggtcctccaagccaagcaatgtgggcttta
ggagataaaattgcgtcgtcaatagtggctcagactgctggcatcccaactcttccttgg
aatggcagtggtcttcgagtggattggcaggagaatgatcttcagaagcgtatcctgaat
gttcctcaggagctgtatgaaaaaggctatgtgaaagatgcagacgatggcctgcgggct
gctgaggaagttggctaccctgtcatgatcaaggcctctgaaggaggaggagggaaggga
attaggaaagtcaataatgcggatgacttccccaacctatttagacaggttcaggctgaa
gtcccaggctctccgatctttgtaatgaggctagccaaacagtcccgccacttggaggtg
cagatcctggcagaccagtatggcaatgccatctctctctttggtcgggattgctccgtg
caacgcaggcatcagaagattattgaagaagcacctgcttctattgcaacttcggtggta
tttgagcacatggaacagtgtgcagtgaagcttgcaaaaatggtggggtatgtgagtgcg
ggcactgtggaatacctgtacagccaggatggcagcttctactttctggagttgaatccc
cgtctgcaagtggagcacccctgcaccgagatggtagctgatgttaatcttcctgcagca
cagctccagattgccatggggattccactccaccgtatcaaggatatccgagtgatgtat
ggtgtttccccatggggagatggatctattgattttgagaattcagcccatgtcccctgt
ccacgtggccatgttattgctgcacgtatcaccagtgagaatcctgatgagggatttaag
cccagttctggtacagtccaggaactgaatttccgcagcaataagaatgtttggggctat
ttcagtgttgctgctgcaggagggctgcatgaatttgctgattctcagtttggtcactgc
ttctcttggggagagaatcgtgaagaagccatctcaaacatggtggtggctttgaaggag
ctgtccatccgaggggatttccgaaccactgttgaatacttgataaaactgttggaaaca
gaaagcttccagcagaaccgcattgacactggctggttggatcggcttattgctgagaaa
gtgcaggctgaaaggcctgataccatgctaggagtggtatgtggagctcttcatgtggct
gatgtgagctttcgaaacagcgtctcaaacttcctgcactctttagaaaggggccaagtc
ctgcctgctcatactttgctaaacactgtggatgtggaactcatctatgaaggacggaaa
tatgtgttgaaggtgacccgacagtctcccaattcctacgtggtcatcatgaacagctct
tgtgtggaagttgatgtgcacagactgagcgatggagggctgctcctatcttacgatggt
agcagctacaccacctacatgaaagaagaagtggacaggtatcgcatcactataggtaac
aagacctgtgtgtttgaaaaggaaaatgatccttctattctgcgctcaccttcggctggg
aagcttatccagtatgtggtggaggatgggggacacgtgtttgcaggccaatgctttgca
gaaatagaggtgatgaaaatggtgatgacactaacagcaggagagtcaggctgcatccat
tatgtcaaacgccccggggcagtgctggatccaggctgtgtgattgccaaactccagctg
gatgatcccagcagggttcagcaggctgaactgcacacaggcaccttgccacagatccag
agcacagcacttcgaggcgaaaaactccatcgcatcttccattatgtcctggataacctg
gtcaacgtgatgaatgggtactgcctgccagagccctactttagcagcaaggtgaagggc
tgggttgagcgactaatgaagacactgagagatccatctttgcctctgctggaacttcag
gacatcatgaccagtgtttctggacggattccacccaatgtggagaagtccatcaagaag
gagatggcccaatatgccagcaacatcacgtcagtcctttgccagtttcccagccaacag
attgccaatatcttggatagccatgcagccaccttgaaccgcaaatcagagcgtgaggtc
tttttcatgaacactcagagtattgtgcagcttgtacagaggtaccggagtggtattcgg
ggtcacatgaaagcagtggtcatggatttgctccgtcaatatctgaaggtggagactcag
tttcagcatggtcactatgacaagtgtgtctttgcccttcgggaagagaataaaagcgac
atgaatgctgtattgaactacatcttctcacatgctcaggtcaccaagaagaacctgctt
gtcacaatgctcattgaccagctctgtggccgtgaccccaccctgacagatgagctgatc
aatattctgacagagctgacccagctcagcaagacaaccaacgccaaagtggcgctgcgg
gcacggcaggttctcattgcttcccatttgccgtcctacgagctgcgtcacaaccaggtg
gagtccatcttcctatctgctattgacatgtatggacaccagttctgcattgagaacctg
cagaaactcattttgtcagagacatccatctttgatgtgctacccaactttttctaccac
agtaatcaggtggtgagaatggcagctttggaggtgtacgttcgaagggcgtacattgcc
tacgagctgaacagcgtccagcaccgccagctgaaggacaacacctgcgtggtggagttc
cagttcatgctgcccacctcccacccaaacagaatgtccttctcttccaacctcaatcac
tacgggatggtccacgtagccagtgtgagtgacgtgctgctggacaactcgttcactccc
ccgtgccagcggatgggagggatggtctctttccgcacgtttgaagattttgtcagaatc
tttgatgaagtgatgagttgtttttgcgactctcctccccagagcccaaccttccctgaa
gctggccatgcttccctctatgatgaagacaaggctgcccgtgaggagcccattcacatt
cttaatgtcgctattaaaactgatggggacgtggatgatgatgggctggcagccatgttc
agagagttcacacaaagcaagaaatcagtcctgattgagcatggcatccggaggctgaca
ttccttgtggcacagaagagggaatttccaaagttcttcacgttccgtgccagggataag
tttgaagaagacagaatctaccgccatctggagccagctctggctttccagctggagctg
aaccgaatgcggaactttgacctcactgccattccatgtgccaaccataaaatgcatctc
tacctgggagcagctaaagttgaagtaggaacagaagtgacagactacaggttctttgtg
agggccattataaggcattcagaccttgttaccaaggaagcctccttcgagtacctgcaa
aacgagggagagcgattgcttttggaagccatggatgagttggaggtggcatttaataat
accaacgtgcgcacggactgcaatcacatcttcttaaattttgtgcctactgtcatcatg
gacccatccaagatcgaggaatccgtgcggagcatggtgatgcgctacgggagccgcctg
tggaagctccgcgtcctccaggccgagctgaagatcaacattcggctgacaccgacagga
aaggccatccccattcgtctcttcctgaccaacgagtcgggctactacctggacatcagc
ctgtacaaagaggtgacggattccaggacagggcagattatgttccaggcctatggggat
aaacagggaccacttcacgggatgctgataaataccccatacgtgaccaaggaccttctt
cagtccaagagattccaggcacagtctttagggacatcctatgtctatgacattcctgag
atgtttcggcagtctttaattaaactctgggattctatgaatgaacatgcattcctgcca
acaccgccgctgccgtctgacatactgacatacactgaattggtgctggatgatcagggc
cagctcgtgcacatgaacaggctgccaggaggaaacgagattgggatggtagcctggaaa
atgaccctcaagaccccggagtatcccgaaggccgtgatatcatcgtcattggcaatgac
attacgtaccggataggttcttttgggcctcaggaggacgtgctgttcctgagggcttca
gagcttgctcgaactcatggcatcccccgcatctacgtggctgccaacagcggagccagg
attggtttggctgaggagatccggcacatgttccatgttgcgtgggaagatccagatgac
ccatacaaaggatacaagtacttgtatctgacacctcaagactataagaaagtcagcgct
ctgaactcagttcactgtgaacacgtggaggacaacggagagtccaggtataagataaca
gatattatcggaaaggaagacggacttggaatagagaacctcagaggatctggcatgatt
gctggagaatcatctttagcctacgagagtattatcaccatcaacttggttacgtgtcgg
gcaattggaattggagcttacctcgttcggttagggcagaggactatccaggttgagaac
tctcacataatcctgactggctgtggagccctcaacaaggtgctgggacgggaggtgtac
acctccaacaaccagctgggcgggatccagatcatgcacaacaacggggtgacccacggc
accgtgtgcgacgattttgaaggagtctacactatcctgctgtggctttcctacatgccc
aagagcgtatacagccctgttcctatcctcaaggtcaaggatcctatagacagaaccata
gacttcgttcctaccaagactccctatgatcctcgctggatgctggctggacgcccaaat
ccaagtcaaaaagggcaatggcagagcggtttctttgacaatggctcgttcctggagatc
atgcagccctgggcacagacggttgtggttggcagagcaaggctgggaggaatacctgta
ggagtagttgccgtagaaaccagaacagtggagctgagcatccctgctgatcccgccaac
ctggactcggaggccaagataatccagcaggctggtcaggtgtggttccccgactctgcc
tttaagacagcccaggccatcaacgacttcaacagagaagggctgcctctgatggtcttt
gccaactggagaggcttctctggtggcatgaaagacatgtacgaccaggtgctcaagttt
ggtgcctacatcgtggacggcctgcgggagtaccggcagcccgtgctcatctacatccca
ccgcaggcggagctcaggggcggctcctgggctgtcatcgaccccaccatcaaccccagg
cacatggagatgtacgcggaccgtgaaagcagagggggaatcctggagccggaggggacg
gtggaaatcaagttccgcaggaaggacctggtgaagacaatgaggagagtggaccccgtc
tacatgcggctggccgagcggctgggtacccctgagctgagtgctgccgaccgaaaagac
ctggagagcaaactgaaggagcgggaggaattcctgattcccatttaccaccaggtggcc
atgcagtttgctgacctgcacgacacacccggccgcatgcaggagaagggtgccatcacg
gacattctggactggaaaacgtctcggaccttcttctactggaggctgagacgtcttctt
ctggaagatgtggtcaaaaagaagatccatgatgccaaccctgagctgaccgacgggcag
atccaggccatgctgcgacgctggtttgtggaagtggaggggacggtaaaggcgtacctg
tgggacagcaataaggacctggtggagtggctggagaagcagctgatggaggaggagggg
gttcgctcggttgtggatgagaacattaagtacatctccagggattacatcctgaagcag
atccgcagcctggtccaggccaatcccgaggttgccatggattcgatcgtgcacatgacc
cagcatatatcacccacccagcgagccgagatcgtgcggatcctctccacaatggactct
ccttcttcaacgtaa

DBGET integrated database retrieval system