KEGG   Gallus gallus (chicken): 396516Help
Entry
396516            CDS       T01006                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1
  KO
K04362  
fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Adherens junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    396516 (FGFR1)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    396516 (FGFR1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    396516 (FGFR1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     396516 (FGFR1)
Protein kinases [BR:gga01001]
 Tyrosine protein kinases
  FGFR family [OT]
   396516 (FGFR1)
Enzyme-linked receptors [BR:gga01020]
 Receptor tyrosine kinases
  RTK class IV (FGF receptor family)
   396516 (FGFR1)
Cytokine receptors [BR:gga04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   396516 (FGFR1)
Cell adhesion molecules and their ligands [BR:gga04516]
 1. Immunoglobulin Superfamily
  Neural system
   5/2 subfamily
    NCAM; neural cell adhesion molecule [KO:K06491]
     396516 (FGFR1)
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     396516 (FGFR1)
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type I classic cadherins
    CDH2; cadherin 2, type 1, N-cadherin [KO:K06736]
     396516 (FGFR1)
CD molecules [BR:gga04090]
 Proteins
  396516 (FGFR1)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   396516 (FGFR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
22
AA seq 819 aa AA seqDB search
MFTWRCLILWAVLVTATLSAARPAPTLPDQALPKANIEVESHSAHPGDLLQLRCRLRDDV
QSINWVRDGVQLPENNRTRITGEEVEVRDAVPEDSGLYACMTNSPSGSETTYFSVNVSDA
LPSAEDDDDEDDSSSEEKEADNTKPNQAVAPYWTYPEKMEKKLHAVPAAKTVKFKCPSGG
TPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENKYGSINHT
YQLDVVERSPHRPILQAGLPANKTVALGSNVEFVCKVYSDPQPHIQWLKHIEVNGSKIGP
DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGISHHSAWLTVLEAT
EQSPAMMTSPLYLEIIIYCTGAFLISCMVVTVIIYKMKSTTKKTDFNSQLAVHKLAKSIP
LRRQVTVSADSSSSMNSGVMLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLILGK
PLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGMEYCYNPTRIPEEQLSFKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVAMTSNQEYLDLSVPLDQYSPGFPA
TRSSTCSSGEDSVFSHDPLPDEPCLPRCPPHSHGALKRH
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtttacctggaggtgcctcatcctttgggctgtgctggtcacagccacgctgtctgct
gccagaccggcccccacgctgcccgaccaagctctgcccaaagcgaacatcgaggtggag
tcccactcggcgcaccccggcgatctcctccagctgcgctgccggctgcgcgatgacgtg
cagagcatcaactgggtgcgtgatggagtgcagctgcccgagaacaaccgcacgcgcatc
accggcgaggaggtagaggtgcgggacgcggtgcccgaggactcggggctctatgcctgc
atgaccaacagcccctcggggagcgagaccacctacttctccgtcaacgtctcagacgca
ctcccttctgcagaggatgatgatgatgaagatgattcctcctcggaggagaaggaggcg
gataacaccaagccgaaccaggctgtagctccttactggacctatcccgagaagatggag
aagaagctgcatgccgtccccgctgccaaaacagtgaaattcaagtgcccctcaggtggg
acgcccaaccccacgctgcgctggctgaagaacggcaaggagttcaagcctgaccaccgc
atcggggggtacaaggtccgctatgccacctggagcatcatcatggactcggtggtgcca
tcagataagggcaactacacgtgcatcgtggagaacaaatacgggagcatcaaccacacc
taccagctggatgtcgtggagcgctccccgcatcggcccatcctgcaggcagggctcccc
gccaacaaaacggtggccctgggcagcaacgtggagtttgtctgcaaggtctacagcgac
ccgcagccccacatccagtggctgaaacacatcgaggtgaacggcagcaagatcggcccc
gacaacttgccctacgtgcagatcctgaagacggctggcgttaacacgacagacaaagag
atggaagtccttcacttaaggaatgtctcatttgaggatgctggggagtatacatgtttg
gcgggtaattctattgggatctcccatcactctgcatggttgacagttctcgaagctact
gagcagtcaccagccatgatgacgtcccccctctacctggagatcatcatttactgcacc
ggcgccttcctcatctcctgcatggtggtgacagtcatcatctacaagatgaagagcacc
accaagaagacagacttcaacagccagctggccgtgcacaagctggccaagagcatccca
ctgcgcagacaggtaacagtgtcagcagattccagctcctccatgaactcgggtgtgatg
ttggtgcggccctcacggctctcctccagcggaacccccatgctggccggcgtctccgag
tatgagctgcccgaggacccgcgctgggagctgccacgggacaggctgatcctgggcaag
ccgctgggagaaggctgctttgggcaggtggtgctggcggaggccatcggcctggacaag
gacaagccaaaccgcgtcaccaaagtggctgtaaagatgctcaagtccgatgccacagag
aaggacctgtccgacctcatctccgagatggagatgatgaagatgatcggcaagcacaag
aacatcatcaacctgctgggtgcctgcacgcaggacgggcccctctatgtcatcgtggag
tacgccagcaaaggcaacctgcgtgagtacctgcaggcacgccgcccaccgggcatggag
tactgctacaaccccacacgcatccccgaggagcagctctccttcaaggacctggtgtcc
tgtgcgtaccaggtggcgcgcggcatggagtacctggcctccaaaaagtgcatccacagg
gacctggcggccaggaacgtgctggtgaccgaggacaacgtgatgaagatcgctgacttc
gggctggcccgcgacatccaccacatcgattactacaagaagacgacaaacggccgcttg
ccggtgaagtggatggccccggaggctctgttcgaccgaatatacacccatcagagtgat
gtttggtcgttcggtgtgctgctgtgggagatcttcacgttgggtggttcgccctacccc
ggcgtgcccgtggaggagctcttcaagctgctgaaggaaggccacaggatggacaagccc
agcaactgcaccaacgagctgtacatgatgatgcgcgactgctggcacgccgtgccctcc
cagcgccccaccttcaagcagctggtggaggacctggacaggatcgtggccatgacctcc
aatcaggagtacctggacctgtcggtgccgttggatcagtactcgcccggcttcccggcc
acgcgcagctccacctgctcctcgggggaggactcggtgttctcccacgacccgctgccc
gacgagccctgcctgccgcgctgccccccgcacagccacggagcgctgaagcggcactga

DBGET integrated database retrieval system