KEGG   Gallus gallus (chicken): 396534Help
Entry
396534            CDS       T01006                                 

Gene name
PAICS, AIRC, AS
Definition
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (EC:6.3.2.6 4.1.1.21)
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
gga  Gallus gallus (chicken)
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gga00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
4
AA seq 426 aa AA seqDB search
MAPAASELKLGKKVNEGKTKEVYELPDIPGCVLMQSKDQITAGNAARKDRMEGKAAISNT
TTSCVFQLLQEAGIKTAFVRKQSDTAFIAAHCEMIPIEWVCRRIATGSFLKRNPGVKEGY
KFYPPKIEMFYKDDANNDPQWSEEQLIEAKFSFAGLTIGKTEVDIMARSTQAIFEILEKS
WQPQNCTLVDLKIEFGVNILTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTP
EALQMVKRNFEWVAERVELLLKTKSQGRVVVLMGSTSDLGHCEKIKKACATFGIPCELRV
TSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVVNCPPLSSDWGA
QDVWSSLRLPSGLGCPTTLSPEGAAQFAAQIFGLNNHLVWAKLRSNMLNTWISLKQADKK
LRECTL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgccgcctcagaactgaaacttggtaaaaaagttaatgagggtaaaacgaaa
gaagtgtatgagctgccggatatcccgggatgcgttctgatgcagtccaaggaccaaata
acagcagggaatgccgctaggaaggaccggatggaggggaaggctgccatctccaacacc
accaccagctgcgtgttccagctgctgcaggaagcaggaatcaaaacggcttttgtcagg
aaacagagtgacacagctttcatagcagctcactgtgaaatgatcccaattgaatgggtc
tgcagaagaattgctactggctctttcctcaaaagaaaccctggtgtcaaagaaggctat
aagttttacccacctaaaattgagatgttttacaaggatgatgccaataatgatccacag
tggtctgaggagcagctaattgaagcaaaattctcttttgctggacttactattggcaag
actgaagtggatattatggctcgttctactcaagctatttttgagatcctggaaaaatca
tggcagccccaaaactgcactctggtggacctgaagattgaatttggtgttaatattttg
accaaagaaattgttcttgctgatgttattgataatgattcatggagactgtggccatcg
ggagacagaagccagcagaaggacaaacagtcctatcgagatctgaaggaagtgactcct
gaagcattgcagatggttaagagaaactttgaatgggttgcagaaagagtagagttgctt
ctgaaaacaaagagccaaggtagagttgtggtattgatgggatctacttctgaccttggc
cactgtgagaaaataaagaaggcatgtgcaacctttggaattccttgtgagttaagagta
acctccgctcacaaagggccagatgaaactctgaggatcaaagcagaatatgaaggagat
ggaatcccgactgtgtttgttgcagtagctggcagaagcaatggtttagggccagtaatg
tctggtaacactgcttaccctgttgtcaactgtcctcccctctcatctgactggggtgct
caggatgtgtggtcctctctcagactgcccagtggtcttggctgtcctactactctgtca
cctgaaggagctgctcagtttgctgcccagatttttggtttaaacaaccacttggtatgg
gccaaactgcgatcaaacatgttaaatacatggatctctttgaagcaggctgacaaaaaa
ttgcgggagtgcaccttgtaa

DBGET integrated database retrieval system