KEGG   Gallus gallus (chicken): 396534Help
Entry
396534            CDS       T01006                                 

Gene name
PAICS, AIRC, AS
Definition
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (EC:6.3.2.6 4.1.1.21)
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
gga  Gallus gallus (chicken)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    396534 (PAICS)
Enzymes [BR:gga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     396534 (PAICS)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     396534 (PAICS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
4
AA seq 426 aa AA seqDB search
MAPAASELKLGKKVNEGKTKEVYELPDIPGCVLMQSKDQITAGNAARKDRMEGKAAISNT
TTSCVFQLLQEAGIKTAFVRKQSDTAFIAAHCEMIPIEWVCRRIATGSFLKRNPGVKEGY
KFYPPKIEMFYKDDANNDPQWSEEQLIEAKFSFAGLTIGKTEVDIMARSTQAIFEILEKS
WQPQNCTLVDLKIEFGVNILTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTP
EALQMVKRNFEWVAERVELLLKTKSQGRVVVLMGSTSDLGHCEKIKKACATFGIPCELRV
TSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVVNCPPLSSDWGA
QDVWSSLRLPSGLGCPTTLSPEGAAQFAAQIFGLNNHLVWAKLRSNMLNTWISLKQADKK
LRECTL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgccgcctcagaactgaaacttggtaaaaaagttaatgagggtaaaacgaaa
gaagtgtatgagctgccggatatcccgggatgcgttctgatgcagtccaaggaccaaata
acagcagggaatgccgctaggaaggaccggatggaggggaaggctgccatctccaacacc
accaccagctgcgtgttccagctgctgcaggaagcaggaatcaaaacggcttttgtcagg
aaacagagtgacacagctttcatagcagctcactgtgaaatgatcccaattgaatgggtc
tgcagaagaattgctactggctctttcctcaaaagaaaccctggtgtcaaagaaggctat
aagttttacccacctaaaattgagatgttttacaaggatgatgccaataatgatccacag
tggtctgaggagcagctaattgaagcaaaattctcttttgctggacttactattggcaag
actgaagtggatattatggctcgttctactcaagctatttttgagatcctggaaaaatca
tggcagccccaaaactgcactctggtggacctgaagattgaatttggtgttaatattttg
accaaagaaattgttcttgctgatgttattgataatgattcatggagactgtggccatcg
ggagacagaagccagcagaaggacaaacagtcctatcgagatctgaaggaagtgactcct
gaagcattgcagatggttaagagaaactttgaatgggttgcagaaagagtagagttgctt
ctgaaaacaaagagccaaggtagagttgtggtattgatgggatctacttctgaccttggc
cactgtgagaaaataaagaaggcatgtgcaacctttggaattccttgtgagttaagagta
acctccgctcacaaagggccagatgaaactctgaggatcaaagcagaatatgaaggagat
ggaatcccgactgtgtttgttgcagtagctggcagaagcaatggtttagggccagtaatg
tctggtaacactgcttaccctgttgtcaactgtcctcccctctcatctgactggggtgct
caggatgtgtggtcctctctcagactgcccagtggtcttggctgtcctactactctgtca
cctgaaggagctgctcagtttgctgcccagatttttggtttaaacaaccacttggtatgg
gccaaactgcgatcaaacatgttaaatacatggatctctttgaagcaggctgacaaaaaa
ttgcgggagtgcaccttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system