KEGG   Gallus gallus (chicken): 396547Help
Entry
396547            CDS       T01006                                 

Gene name
NAGA
Definition
N-acetylgalactosaminidase, alpha- (EC:3.2.1.49)
Orthology
K01204  
alpha-N-acetylgalactosaminidase [EC:3.2.1.49]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    396547 (NAGA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    396547 (NAGA)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.49  alpha-N-acetylgalactosaminidase
     396547 (NAGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 425 aa AA seqDB search
MGVPAAVAVLAVALALPARGLENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFME
MADRIAEDGWRELGYKYINIDDCWAAKQRDTEGRLVPDPERFPRGIKALADYVHARGLKL
GIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARAL
NATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQ
DVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKI
LQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLA
KLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKALLIQQQAPGGPS
RLPLL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgggggttccggcggctgtcgcggtcctggctgtggcgttggcgctgcccgcccgcggg
ctggagaacgggctggcgcggaccccgcccatgggctggttggcctgggagcggttccgc
tgcaacgtgaactgccgggaggacccccgccagtgcatcagtgagatgctcttcatggag
atggcagaccgaatagcagaggacggctggagggagctgggctacaagtacatcaatatc
gatgactgctgggccgccaagcagcgtgacactgaggggcggctggtgcctgaccccgag
aggttcccccggggcattaaggccttggctgactacgttcatgcccgaggcttgaagctg
ggcatttatggcgacctgggcagactcacctgtggaggctacccaggcaccacgctggac
cgtgtggagcaggacgcacagaccttcgctgagtggggtgtggacatgctgaagctagat
gggtgctactcatcggggaaggagcaggcacagggctacccacaaatggcaagggccttg
aacgccactggccgccccatcgtctactcctgcagctggccagcctaccagggggggctg
cctcccaaggtgaactacactctcctgggtgagatctgcaacctgtggcggaactacgat
gacatccaggactcatgggacagcgtgctttccatcgtggactggttcttcacaaaccag
gatgtgctgcagccgtttgctggccctggccactggaatgacccagacatgctcatcatt
ggaaatttcggtctcagctatgagcagtcacgttcccaaatggccttgtggaccattatg
gcagctccactcctcatgtccaccgacctgcgcactatctcgccgagtgccaagaagatc
ctgcagaaccgcctgatgatccagataaaccaggaccccttgggaatccaggggcgcagg
atcatcaaggagggatcccacattgaggtgttcctgcgcccgctgtcacaggctgccagt
gccctggtgttcttcagccggaggacagacatgcccttccgctacaccaccagtctggcc
aagcttggcttccccatgggagctgcatatgaggtgcaagacgtgtacagtgggaagatc
atcagtggcctgaagacaggagacaacttcacagtgatcatcaacccctcaggggtggtg
atgtggtacctgtgtcccaaagcactgctcatccagcagcaagctcctggggggccctca
cgcctgccccttctgtga

DBGET integrated database retrieval system