KEGG   Gallus gallus (chicken): 408039Help
Entry
408039            CDS       T01006                                 

Gene name
KRT14, CK-14, K14
Definition
(RefSeq) keratin 14
  KO
K07604  
type I keratin, acidic
Organism
gga  Gallus gallus (chicken)
Brite
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     408039 (KRT14)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   408039 (KRT14)
  Exosomal proteins of other body fluids (saliva and urine)
   408039 (KRT14)
  Exosomal proteins of colorectal cancer cells
   408039 (KRT14)
  Exosomal proteins of melanoma cells
   408039 (KRT14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
27
AA seq 467 aa AA seqDB search
MSTTVRQFSSSTSLKGLGGGSSRLSCGRAAGYRAPSVHGGSSSYSVSSRIVSGLGAGYGG
GYCSSVGGGLGGGFGASYGAGYGAGFGGGFGAGFGGGFGGGDGILPAGEKETMQNLNDRL
AAYLDKVRALEEANTDLEVKIREWYKKQGPGPERDYSPYYRTIEELRSKILAATVENANI
VLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLSRADLEMQIENLKEEL
AYLKKNHEEEMNALRGQVGGEISVEMDAAPGIDLTKILAEMREQYESLAEKNRRDAEQWF
FSKTEELNREVAVNTEQLQSGKTEITELRRTIQSLEIDLQSQLSTKAALEGTLADTEARY
GTQLAQLQALITSVEEQLAELRCDMERQNHEYRVLLDVKCRLEQEIATYRRLLEGEDAHI
SSQYSSAMSSHSGRDAITTSRQVRTIVEEVQDGKVVSSREQMALTTR
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccactgtccggcagttctcctcctccacctccctcaagggactgggggggggc
tccagcaggctgtcctgtggccgggcagcgggctaccgggcccccagtgtccatgggggc
tccagcagctactccgtctcctcccgcatcgtctcggggctcggcgccggctatgggggc
ggctactgcagcagtgtcggagggggcctcggcgggggcttcggggccagctatggggcc
ggctatggggctggcttcgggggcggctttggggccggcttcgggggcggcttcgggggc
ggcgatggcatcctcccggccggcgagaaggaaacaatgcagaacctcaacgaccgcctg
gccgcctacctggacaaggtgcgcgccctggaggaggccaacactgatctggaggtgaag
atcagggagtggtacaagaagcaggggcccggccctgagcgcgactacagcccctactac
cggaccatcgaggagctgcgcagcaagattcttgccgcaactgttgagaatgccaacatt
gtcctgcagattgacaatgccaggctggcagctgatgacttcagaaccaagtttgagacg
gagcaggccctgcgtctgagcgtggaggccgacatcaacgggctgcgcagggtgctggat
gagctgaccctgtccagggctgacctggagatgcagattgagaacctgaaggaggagcta
gcctacctgaagaagaaccacgaggaggaaatgaacgcgctgcgcggacaggtgggagga
gagatcagcgtggagatggacgcggctcccggcattgacctcaccaagatcctggctgag
atgcgggagcagtacgagagcctggcggagaagaaccggcgggatgctgagcagtggttc
ttcagcaagacggaggagctgaaccgcgaggtggccgtcaacacggagcagctgcagagc
ggcaagacggagatcacggagctgcgccgcaccatccagagcctggagatcgacctgcag
tcccagctcagcacgaaagcggcgctggagggcaccctggccgacaccgaggcgcgctac
ggcacccagctggcccagctgcaggcgctgatcaccagcgtggaggagcagctggccgag
ctgcgctgtgacatggagcggcagaaccacgagtaccgcgtgctgctggacgtcaagtgc
cgcctggagcaggagatcgccacgtaccgccggctgctggagggcgaggacgcccacatc
tcttcccagtactcctctgcaatgtcctcacactctggcagagacgccattacgacctcg
cgccaggtgcgcaccatcgtggaggaggtgcaggacgggaaggtggtctcatcccgtgag
cagatggcgctcaccacacgctag

DBGET integrated database retrieval system