KEGG   Gallus gallus (chicken): 408047Help
Entry
408047            CDS       T01006                                 

Gene name
TMSB4X
Definition
thymosin beta 4, X-linked
Orthology
K05764  
thymosin, beta 4
Organism
gga  Gallus gallus (chicken)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    408047 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
1
AA seq 45 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGESK
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaaacccgacatggccgagatcgagaaatttgacaagtccaaactgaagaag
acagagacgcaagagaaaaacccgctgccttcaaaagaaacgattgaacaggagaagcaa
gcgggtgaatcgaaatga

DBGET integrated database retrieval system