KEGG   Gallus gallus (chicken): 408047Help
Entry
408047            CDS       T01006                                 

Gene name
TMSB4X
Definition
(RefSeq) thymosin beta 4, X-linked
  KO
K05764  thymosin, beta 4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    408047 (TMSB4X)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     408047 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymosin WH2 DUF4522
Motif
Other DBs
NCBI-GeneID: 408047
NCBI-ProteinID: NP_001001315
CGNC: 49900
Ensembl: ENSGALG00000026383
UniProt: Q6WEB3
Position
1
AA seq 45 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGESK
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaaacccgacatggccgagatcgagaaatttgacaagtccaaactgaagaag
acagagacgcaagagaaaaacccgctgccttcaaaagaaacgattgaacaggagaagcaa
gcgggtgaatcgaaatga

DBGET integrated database retrieval system