KEGG   Gallus gallus (chicken): 408182Help
Entry
408182            CDS       T01006                                 

Gene name
CYB5R2, b5R.2, b5r
Definition
cytochrome b5 reductase 2 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
gga  Gallus gallus (chicken)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    408182 (CYB5R2)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     408182 (CYB5R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
5
AA seq 304 aa AA seqDB search
MEAFSGTPVVVAVAAVAATVLLLLLLRGAGRRPGRPVTLRDPQAKYPLPLVGKEEISHDT
KKFRFGLPSPDHVLGLPVGQHVYLSAKINGNLVIRAYTPVSSDETKGYVDLIIKVYYKNV
NPKFPEGGKMSQYLDSMKIGDVIDFRGPNGLLVYKGSGTFMIKPDKKSEAQRKFAKHLGM
IAGGTGITPMLQLIRHITSDPKDSTKCYLLFANQTEKDILLRAELEDIAKRHPDQVRLWY
TLDRPPQDWKYSSGFVTADMIKTHLPPPGSETLILMCGPPPMIQFACQPNLDKLGYPKSS
TFSY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgttctcgggtacccccgtggtcgtcgccgtggccgcggtggccgcgacggtg
ctgctgctgctgctgctcagaggggcgggacggaggccgggccgcccggtcacgctgcgg
gacccgcaggccaaatacccgctgccgctggtgggcaaagaggagatcagccacgacacc
aagaaattccggtttgggctcccttcaccagatcatgtcttaggattacctgtaggccaa
cacgtttacctttctgcaaaaatcaatggtaatctggtgatccgagcctacaccccggtt
tccagtgatgagacaaaaggctatgttgatttaattataaaggtttactacaaaaatgtg
aatcccaagttcccagaaggtgggaagatgtcccagtaccttgacagcatgaagattgga
gatgttattgacttcagggggccaaacggactgcttgtctacaaggggtcaggtaccttt
atgatcaagcctgataagaagtctgaagcacagaggaagtttgcaaagcatcttgggatg
atagctggaggaacaggaataactcctatgttgcagctgatccgtcatatcacaagtgac
cctaaggactctacaaagtgttaccttctttttgctaatcagacagagaaggacatattg
ctcagagctgagctagaagacattgctaagaggcatcctgatcaggtcaggctctggtat
acgctggacaggcctccacaagattggaagtacagttctggtttcgtcactgcagacatg
attaaaacccacctccctccccctggcagtgagacgctcattcttatgtgtgggccacca
cctatgattcagtttgcctgtcagcccaacctggacaaactcggctatcccaagagcagt
acattttcctattaa

DBGET integrated database retrieval system