KEGG   Gallus gallus (chicken): 414832Help
Entry
414832            CDS       T01006                                 

Gene name
CYP3A7, CYP3A37
Definition
cytochrome P450 A 37
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    414832 (CYP3A7)
   00591 Linoleic acid metabolism
    414832 (CYP3A7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    414832 (CYP3A7)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     414832 (CYP3A7)
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP3 family
   414832 (CYP3A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
14
AA seq 508 aa AA seqDB search
MNFLPFFSIETWIILLIFVVLLIIYGTWPFGLFKKLGIPGPRPLPFFGTCLEYRKGFLDF
DTECFQKYGKIWGIYDGRQPAVVVMDPQIIKTVLVKECYSTFTNRRRTDLAGVLRNAVSL
AEDDQWKRLRTVLSPTFTSGKLKEMFPTMKYFGEMLVKNIQKRVEKNSSVPVKDFFGSYS
MDVVTSTSFGVNIDSMNNPKSPFVREMQKLTKFDFFDPVFILSFVCPFLTPLMAKMNISF
FPSDAVDFFMRSIDKIKKDRERETHTGRVDFLQMMIESQKSDSNGSSDAKHSYKALSDIE
VLSQAFIFIFAGYEPTSNTLGYLAYQLALHPDVQQKVVNEIDTILPNKAPLTYEAIMQLE
YLDMAVNETLRLYPLGGRLERTCKRDVEINGVTIPKGTIVIIPPYTLHRSPEYWPNPEEF
RPERFSKENKDNIDPYTYLPFGAGPRNCIGMRFALLTLKVAITAVLQHFTFQVCKETQIP
LKLQSLGLTTPEKPIVLKLVPRTNTAKA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaactttcttcctttcttctccattgaaacctggatcatcttgcttatttttgtagtc
ctcctgataatatacggaacatggccatttgggttgttcaagaagctgggcattcctggg
ccaagaccattgcctttctttgggacatgcctggaataccgcaaaggcttcttggatttt
gacactgagtgcttccagaagtatgggaaaatctgggggatttacgatggcaggcagcct
gcggttgttgtcatggacccccagatcatcaaaaccgtgctggtgaaagagtgctactcc
accttcaccaaccgcaggcgcacggatctagcaggggtactgagaaacgctgtctcatta
gctgaagatgatcagtggaaaaggctccgcactgtgctctctccaaccttcaccagtggg
aagctaaaggagatgtttcctacaatgaagtactttggggaaatgttggtgaaaaatatt
caaaaaagagtggaaaagaacagctctgtccctgtgaaggacttctttggaagctacagc
atggacgtagtcacaagcacttccttcggtgtgaacatcgactccatgaacaaccccaaa
agcccctttgtcagagagatgcagaagctgaccaagtttgacttctttgatccagtcttc
atcttgtcatttgtatgtccattcctcactcctcttatggccaagatgaacatcagcttt
ttccccagtgatgctgtagatttcttcatgaggtctattgacaaaatcaagaaggatcgt
gaaagggagactcacacgggcagagtagatttcctgcagatgatgatcgaatcccagaaa
tcagacagcaatgggagcagcgatgcgaagcactcgtataaagccttgagtgacatagag
gtcctgtcacaagcattcatcttcatttttgctgggtatgagcccaccagtaacacactt
ggttacctggcttaccagctggccttgcatcctgatgtacagcagaaggtggtgaatgaa
atagataccatactacccaataaggctccgctcacgtatgaagcgataatgcagttggaa
tacctcgacatggccgtgaatgaaaccctccggctctatcctctcggaggacggcttgag
agaacctgcaagagagatgtggaaataaacggggtgaccattccaaaaggaacaattgtt
atcatcccaccttacaccctgcaccgcagccccgagtactggccaaacccagaagagttc
agaccagaaaggttcagtaaggaaaataaagacaacatagacccatacacatacctacct
tttggagctggtcccaggaactgcattgggatgcgatttgctctcctgactctgaaagtt
gccatcactgctgtattgcagcacttcaccttccaggtctgcaaagaaacccagatccct
ctcaagctgcagtcgctgggactcacgaccccagagaagcccattgttctcaagctagtc
cctcggaccaacactgccaaggcatag

DBGET integrated database retrieval system